Lineage for d1fxjb2 (1fxj B:3-251)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 73507Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
  4. 73508Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (12 families) (S)
  5. 73534Family c.68.1.5: N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain [53461] (1 protein)
  6. 73535Protein N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain [53462] (2 species)
  7. 73536Species Escherichia coli [TaxId:562] [53463] (3 PDB entries)
  8. 73540Domain d1fxjb2: 1fxj B:3-251 [34521]
    Other proteins in same PDB: d1fxja1, d1fxjb1

Details for d1fxjb2

PDB Entry: 1fxj (more details), 2.25 Å

PDB Description: crystal structure of n-acetylglucosamine 1-phosphate uridyltransferase

SCOP Domain Sequences for d1fxjb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fxjb2 c.68.1.5 (B:3-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Escherichia coli}
nnamsvvilaagkgtrmysdlpkvlhtlagkamvqhvidaanelgaahvhlvyghggdll
kqalkddnlnwvlqaeqlgtghamqqaapffaddedilmlygdvplisvetlqrlrdakp
qggiglltvklddptgygritrengkvtgivehkdatdeqrqiqeintgiliangadmkr
wlakltnnnaqgeyyitdiialayqegreivavhpqrlsevegvnnrlqlsrlervyqse
qaeklllag

SCOP Domain Coordinates for d1fxjb2:

Click to download the PDB-style file with coordinates for d1fxjb2.
(The format of our PDB-style files is described here.)

Timeline for d1fxjb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fxjb1