Lineage for d4cr2z2 (4cr2 Z:49-367)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2334625Superfamily a.118.28: Proteasome regulatory subunit Rpn2 N-terminal domain-like [345915] (1 family) (S)
  5. 2334626Family a.118.28.1: Proteasome regulatory subunit Rpn2, N-terminal domain-like [345956] (2 protein domains)
  6. 2334627Protein Proteasome regulatory subunit Rpn1, N-terminal domain [346040] (1 species)
  7. 2334628Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346203] (1 PDB entry)
  8. 2334629Domain d4cr2z2: 4cr2 Z:49-367 [345207]
    Other proteins in same PDB: d4cr21_, d4cr22_, d4cr23_, d4cr24_, d4cr25_, d4cr26_, d4cr27_, d4cr2a_, d4cr2b_, d4cr2c_, d4cr2d_, d4cr2e_, d4cr2f_, d4cr2g_, d4cr2h1, d4cr2h2, d4cr2h3, d4cr2i1, d4cr2i2, d4cr2i3, d4cr2j1, d4cr2j2, d4cr2j3, d4cr2k1, d4cr2k2, d4cr2k3, d4cr2l1, d4cr2l2, d4cr2l3, d4cr2m1, d4cr2m2, d4cr2m3, d4cr2n1, d4cr2n2, d4cr2n3, d4cr2o1, d4cr2o2, d4cr2p1, d4cr2p2, d4cr2q1, d4cr2q2, d4cr2r1, d4cr2r2, d4cr2s1, d4cr2s2, d4cr2t1, d4cr2t2, d4cr2u1, d4cr2u2, d4cr2v1, d4cr2v2, d4cr2w_, d4cr2x_, d4cr2y_, d4cr2z1, d4cr2z3

Details for d4cr2z2

PDB Entry: 4cr2 (more details), 7.7 Å

PDB Description: deep classification of a large cryo-em dataset defines the conformational landscape of the 26s proteasome
PDB Compounds: (Z:) 26s proteasome regulatory subunit rpn1

SCOPe Domain Sequences for d4cr2z2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cr2z2 a.118.28.1 (Z:49-367) Proteasome regulatory subunit Rpn1, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lellverlkeddsslyeaslnalkesiknstssmtavpkplkflrptypdlcsiydkwtd
pnlkssladvlsilamtysengkhdslryrllsdvsdfegwgheyirhlaleigevyndq
vekdaedetssdgsksdgsaatsgfefskedtlrlcldivpyflkhngeedavdllleie
sidklpqfvdentfqrvcqymvacvpllpppedvaflktaysiylsqneltdaialavrl
geedmirsvfdatsdpvmhkqlayilaaqktsfeyegvqdiigngklsehflylakelnl
tgpkvpediykshldnsks

SCOPe Domain Coordinates for d4cr2z2:

Click to download the PDB-style file with coordinates for d4cr2z2.
(The format of our PDB-style files is described here.)

Timeline for d4cr2z2:

  • d4cr2z2 is new in SCOPe 2.07-stable

View in 3D
Domains from other chains:
(mouse over for more information)
d4cr21_, d4cr22_, d4cr23_, d4cr24_, d4cr25_, d4cr26_, d4cr27_, d4cr2a_, d4cr2b_, d4cr2c_, d4cr2d_, d4cr2e_, d4cr2f_, d4cr2g_, d4cr2h1, d4cr2h2, d4cr2h3, d4cr2i1, d4cr2i2, d4cr2i3, d4cr2j1, d4cr2j2, d4cr2j3, d4cr2k1, d4cr2k2, d4cr2k3, d4cr2l1, d4cr2l2, d4cr2l3, d4cr2m1, d4cr2m2, d4cr2m3, d4cr2n1, d4cr2n2, d4cr2n3, d4cr2o1, d4cr2o2, d4cr2p1, d4cr2p2, d4cr2q1, d4cr2q2, d4cr2r1, d4cr2r2, d4cr2s1, d4cr2s2, d4cr2t1, d4cr2t2, d4cr2u1, d4cr2u2, d4cr2v1, d4cr2v2, d4cr2w_, d4cr2x_, d4cr2y_