Lineage for d4cr2x_ (4cr2 X:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2394380Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2395134Superfamily b.55.3: Pleckstrin-like receptor for ubiquitin (Pru) domain [345921] (1 family) (S)
    Pfam PF04683
  5. 2395135Family b.55.3.1: Pleckstrin-like receptor for ubiquitin (Pru) domain [345964] (1 protein)
  6. 2395136Protein Proteasome regulatory subunit Rpn13 [346056] (1 species)
  7. 2395137Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346249] (1 PDB entry)
  8. 2395138Domain d4cr2x_: 4cr2 X: [345204]
    Other proteins in same PDB: d4cr21_, d4cr22_, d4cr23_, d4cr24_, d4cr25_, d4cr26_, d4cr27_, d4cr2a_, d4cr2b_, d4cr2c_, d4cr2d_, d4cr2e_, d4cr2f_, d4cr2g_, d4cr2h1, d4cr2h2, d4cr2h3, d4cr2i1, d4cr2i2, d4cr2i3, d4cr2j1, d4cr2j2, d4cr2j3, d4cr2k1, d4cr2k2, d4cr2k3, d4cr2l1, d4cr2l2, d4cr2l3, d4cr2m1, d4cr2m2, d4cr2m3, d4cr2n1, d4cr2n2, d4cr2n3, d4cr2o1, d4cr2o2, d4cr2p1, d4cr2p2, d4cr2q1, d4cr2q2, d4cr2r1, d4cr2r2, d4cr2s1, d4cr2s2, d4cr2t1, d4cr2t2, d4cr2u1, d4cr2u2, d4cr2v1, d4cr2v2, d4cr2w_, d4cr2y_, d4cr2z1, d4cr2z2, d4cr2z3

Details for d4cr2x_

PDB Entry: 4cr2 (more details), 7.7 Å

PDB Description: deep classification of a large cryo-em dataset defines the conformational landscape of the 26s proteasome
PDB Compounds: (X:) 26S proteasome regulatory subunit RPN13

SCOPe Domain Sequences for d4cr2x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cr2x_ b.55.3.1 (X:) Proteasome regulatory subunit Rpn13 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vikfragvceynedsrlctpipvqgeieikpneeeelgfwdfewrptekpvgreldpisl
ilipgetmwvpikssksgrifalvfssneryffwlqeknsgnlplnelsakdkeiynkmi
gvlnnss

SCOPe Domain Coordinates for d4cr2x_:

Click to download the PDB-style file with coordinates for d4cr2x_.
(The format of our PDB-style files is described here.)

Timeline for d4cr2x_:

  • d4cr2x_ is new in SCOPe 2.07-stable

View in 3D
Domains from other chains:
(mouse over for more information)
d4cr21_, d4cr22_, d4cr23_, d4cr24_, d4cr25_, d4cr26_, d4cr27_, d4cr2a_, d4cr2b_, d4cr2c_, d4cr2d_, d4cr2e_, d4cr2f_, d4cr2g_, d4cr2h1, d4cr2h2, d4cr2h3, d4cr2i1, d4cr2i2, d4cr2i3, d4cr2j1, d4cr2j2, d4cr2j3, d4cr2k1, d4cr2k2, d4cr2k3, d4cr2l1, d4cr2l2, d4cr2l3, d4cr2m1, d4cr2m2, d4cr2m3, d4cr2n1, d4cr2n2, d4cr2n3, d4cr2o1, d4cr2o2, d4cr2p1, d4cr2p2, d4cr2q1, d4cr2q2, d4cr2r1, d4cr2r2, d4cr2s1, d4cr2s2, d4cr2t1, d4cr2t2, d4cr2u1, d4cr2u2, d4cr2v1, d4cr2v2, d4cr2w_, d4cr2y_, d4cr2z1, d4cr2z2, d4cr2z3