Lineage for d4cr2v1 (4cr2 V:23-217)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2489936Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2490288Superfamily c.97.3: JAB1/MPN domain [102712] (2 families) (S)
  5. 2490289Family c.97.3.1: JAB1/MPN domain [102713] (8 protein domains)
    Pfam PF01398; Pfam PF14464; synonyms Mov34, PAD-1. PubMed 17559875 asserts homology to (c.97.1)
  6. 2490314Protein Proteasome regulatory subunit Rpn11 [346088] (1 species)
  7. 2490315Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346338] (5 PDB entries)
  8. 2490320Domain d4cr2v1: 4cr2 V:23-217 [345201]
    Other proteins in same PDB: d4cr21_, d4cr22_, d4cr23_, d4cr24_, d4cr25_, d4cr26_, d4cr27_, d4cr2a_, d4cr2b_, d4cr2c_, d4cr2d_, d4cr2e_, d4cr2f_, d4cr2g_, d4cr2h1, d4cr2h2, d4cr2h3, d4cr2i1, d4cr2i2, d4cr2i3, d4cr2j1, d4cr2j2, d4cr2j3, d4cr2k1, d4cr2k2, d4cr2k3, d4cr2l1, d4cr2l2, d4cr2l3, d4cr2m1, d4cr2m2, d4cr2m3, d4cr2n1, d4cr2n2, d4cr2n3, d4cr2o1, d4cr2o2, d4cr2p1, d4cr2p2, d4cr2q1, d4cr2q2, d4cr2r1, d4cr2r2, d4cr2s1, d4cr2s2, d4cr2t1, d4cr2t2, d4cr2u1, d4cr2u2, d4cr2v2, d4cr2w_, d4cr2x_, d4cr2y_, d4cr2z1, d4cr2z2, d4cr2z3

Details for d4cr2v1

PDB Entry: 4cr2 (more details), 7.7 Å

PDB Description: deep classification of a large cryo-em dataset defines the conformational landscape of the 26s proteasome
PDB Compounds: (V:) 26s proteasome regulatory subunit rpn11

SCOPe Domain Sequences for d4cr2v1:

Sequence, based on SEQRES records: (download)

>d4cr2v1 c.97.3.1 (V:23-217) Proteasome regulatory subunit Rpn11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tketvyissiallkmlkhgragvpmevmglmlgefvddytvnvvdvfampqsgtgvsvea
vddvfqakmmdmlkqtgrdqmvvgwyhshpgfgcwlssvdvntqksfeqlnsravavvvd
piqsvkgkvvidafrlidtgalinnleprqttsntgllnkaniqalihglnrhyyslnid
yhktaketkmlmnlh

Sequence, based on observed residues (ATOM records): (download)

>d4cr2v1 c.97.3.1 (V:23-217) Proteasome regulatory subunit Rpn11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tketvyissiallkmlkhgragvpmevmglmlgefvddytvnvvdvfampqsgtgvsvea
vddvfqakmmdmlkqtgrdqmvvgwyhshpgfgcwlssvdvntqksfeqlnsravavvvd
piqsvkgkvvidafrlidtgalinnllnkaniqalihglnrhyyslnidyhktaketkml
mnlh

SCOPe Domain Coordinates for d4cr2v1:

Click to download the PDB-style file with coordinates for d4cr2v1.
(The format of our PDB-style files is described here.)

Timeline for d4cr2v1:

  • d4cr2v1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d4cr2v2
View in 3D
Domains from other chains:
(mouse over for more information)
d4cr21_, d4cr22_, d4cr23_, d4cr24_, d4cr25_, d4cr26_, d4cr27_, d4cr2a_, d4cr2b_, d4cr2c_, d4cr2d_, d4cr2e_, d4cr2f_, d4cr2g_, d4cr2h1, d4cr2h2, d4cr2h3, d4cr2i1, d4cr2i2, d4cr2i3, d4cr2j1, d4cr2j2, d4cr2j3, d4cr2k1, d4cr2k2, d4cr2k3, d4cr2l1, d4cr2l2, d4cr2l3, d4cr2m1, d4cr2m2, d4cr2m3, d4cr2n1, d4cr2n2, d4cr2n3, d4cr2o1, d4cr2o2, d4cr2p1, d4cr2p2, d4cr2q1, d4cr2q2, d4cr2r1, d4cr2r2, d4cr2s1, d4cr2s2, d4cr2t1, d4cr2t2, d4cr2u1, d4cr2u2, d4cr2w_, d4cr2x_, d4cr2y_, d4cr2z1, d4cr2z2, d4cr2z3