Lineage for d4cr2s1 (4cr2 S:126-382)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2339718Superfamily a.118.8: TPR-like [48452] (10 families) (S)
  5. 2340010Family a.118.8.9: TPR-like repeats from PCI (proteasome / COP9 signalosome / eIF3) domains [345951] (10 proteins)
    N-terminal part of Pfam PF06272
    Described in PubMed 15180986 as 'HAM (HEAT analagous motif) domain'
    Probably homologous to TPR rather than HEAT, based on PubMed 15790418

    this is a repeat family; one repeat unit is 4cr2 O:123-163 found in domain
  6. 2340026Protein Proteasome regulatory subunit Rpn3, N-terminal domain [346034] (1 species)
  7. 2340027Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346196] (1 PDB entry)
  8. 2340028Domain d4cr2s1: 4cr2 S:126-382 [345195]
    Other proteins in same PDB: d4cr21_, d4cr22_, d4cr23_, d4cr24_, d4cr25_, d4cr26_, d4cr27_, d4cr2a_, d4cr2b_, d4cr2c_, d4cr2d_, d4cr2e_, d4cr2f_, d4cr2g_, d4cr2h1, d4cr2h2, d4cr2h3, d4cr2i1, d4cr2i2, d4cr2i3, d4cr2j1, d4cr2j2, d4cr2j3, d4cr2k1, d4cr2k2, d4cr2k3, d4cr2l1, d4cr2l2, d4cr2l3, d4cr2m1, d4cr2m2, d4cr2m3, d4cr2n1, d4cr2n2, d4cr2n3, d4cr2o1, d4cr2o2, d4cr2p1, d4cr2p2, d4cr2q1, d4cr2q2, d4cr2r1, d4cr2r2, d4cr2s2, d4cr2t1, d4cr2t2, d4cr2u1, d4cr2u2, d4cr2v1, d4cr2v2, d4cr2w_, d4cr2x_, d4cr2y_, d4cr2z1, d4cr2z2, d4cr2z3

Details for d4cr2s1

PDB Entry: 4cr2 (more details), 7.7 Å

PDB Description: deep classification of a large cryo-em dataset defines the conformational landscape of the 26s proteasome
PDB Compounds: (S:) 26s proteasome regulatory subunit rpn3

SCOPe Domain Sequences for d4cr2s1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cr2s1 a.118.8.9 (S:126-382) Proteasome regulatory subunit Rpn3, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ktievtaeincfmhllvqlflwdskeleqlvefnrkvvipnllcyynlrslnlinaklwf
yiylshetlarsseeinsdnqniilrstmmkflkiaslkhdnetkamlinlilrdflnng
evdsasdfiskleyphtdvssslearyffylskinaiqldystaneyiiaairkaphnsk
slgflqqsnklhcciqllmgdipelsffhqsnmqksllpyyhltkavklgdlkkftstit
kykqlllkddtyqlcvr

SCOPe Domain Coordinates for d4cr2s1:

Click to download the PDB-style file with coordinates for d4cr2s1.
(The format of our PDB-style files is described here.)

Timeline for d4cr2s1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4cr2s2
View in 3D
Domains from other chains:
(mouse over for more information)
d4cr21_, d4cr22_, d4cr23_, d4cr24_, d4cr25_, d4cr26_, d4cr27_, d4cr2a_, d4cr2b_, d4cr2c_, d4cr2d_, d4cr2e_, d4cr2f_, d4cr2g_, d4cr2h1, d4cr2h2, d4cr2h3, d4cr2i1, d4cr2i2, d4cr2i3, d4cr2j1, d4cr2j2, d4cr2j3, d4cr2k1, d4cr2k2, d4cr2k3, d4cr2l1, d4cr2l2, d4cr2l3, d4cr2m1, d4cr2m2, d4cr2m3, d4cr2n1, d4cr2n2, d4cr2n3, d4cr2o1, d4cr2o2, d4cr2p1, d4cr2p2, d4cr2q1, d4cr2q2, d4cr2r1, d4cr2r2, d4cr2t1, d4cr2t2, d4cr2u1, d4cr2u2, d4cr2v1, d4cr2v2, d4cr2w_, d4cr2x_, d4cr2y_, d4cr2z1, d4cr2z2, d4cr2z3