Lineage for d4cr2p2 (4cr2 P:326-442)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694159Family a.4.5.47: C-terminal part of PCI (proteasome COP9/signalosome eIF3) domains (PINT motif) [109671] (11 proteins)
    Pfam PF01399
    some members have long C-terminal tail with helix
  6. 2694184Protein Proteasome regulatory subunit Rpn5, C-terminal domain [346016] (1 species)
  7. 2694185Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346160] (1 PDB entry)
  8. 2694186Domain d4cr2p2: 4cr2 P:326-442 [345190]
    Other proteins in same PDB: d4cr21_, d4cr22_, d4cr23_, d4cr24_, d4cr25_, d4cr26_, d4cr27_, d4cr2a_, d4cr2b_, d4cr2c_, d4cr2d1, d4cr2d2, d4cr2e_, d4cr2f_, d4cr2g_, d4cr2h1, d4cr2h2, d4cr2h3, d4cr2i1, d4cr2i2, d4cr2i3, d4cr2j1, d4cr2j2, d4cr2j3, d4cr2k1, d4cr2k2, d4cr2k3, d4cr2l1, d4cr2l2, d4cr2l3, d4cr2m1, d4cr2m2, d4cr2m3, d4cr2n1, d4cr2n2, d4cr2n3, d4cr2o1, d4cr2o2, d4cr2p1, d4cr2q1, d4cr2q2, d4cr2r1, d4cr2r2, d4cr2s1, d4cr2s2, d4cr2t1, d4cr2t2, d4cr2u1, d4cr2u2, d4cr2v1, d4cr2v2, d4cr2w_, d4cr2x_, d4cr2y_, d4cr2z1, d4cr2z2, d4cr2z3
    has additional insertions and/or extensions that are not grouped together

Details for d4cr2p2

PDB Entry: 4cr2 (more details), 7.7 Å

PDB Description: deep classification of a large cryo-em dataset defines the conformational landscape of the 26s proteasome
PDB Compounds: (P:) 26s proteasome regulatory subunit rpn5

SCOPe Domain Sequences for d4cr2p2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cr2p2 a.4.5.47 (P:326-442) Proteasome regulatory subunit Rpn5, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dlafggeankhhwedlqkrviehnlrviseyysritllrlnelldltesqtetyisdlvn
qgiiyakvnrpakivnfekpknssqllnewshnvdellehietighlitkeeimhgl

SCOPe Domain Coordinates for d4cr2p2:

Click to download the PDB-style file with coordinates for d4cr2p2.
(The format of our PDB-style files is described here.)

Timeline for d4cr2p2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4cr2p1
View in 3D
Domains from other chains:
(mouse over for more information)
d4cr21_, d4cr22_, d4cr23_, d4cr24_, d4cr25_, d4cr26_, d4cr27_, d4cr2a_, d4cr2b_, d4cr2c_, d4cr2d1, d4cr2d2, d4cr2e_, d4cr2f_, d4cr2g_, d4cr2h1, d4cr2h2, d4cr2h3, d4cr2i1, d4cr2i2, d4cr2i3, d4cr2j1, d4cr2j2, d4cr2j3, d4cr2k1, d4cr2k2, d4cr2k3, d4cr2l1, d4cr2l2, d4cr2l3, d4cr2m1, d4cr2m2, d4cr2m3, d4cr2n1, d4cr2n2, d4cr2n3, d4cr2o1, d4cr2o2, d4cr2q1, d4cr2q2, d4cr2r1, d4cr2r2, d4cr2s1, d4cr2s2, d4cr2t1, d4cr2t2, d4cr2u1, d4cr2u2, d4cr2v1, d4cr2v2, d4cr2w_, d4cr2x_, d4cr2y_, d4cr2z1, d4cr2z2, d4cr2z3