Lineage for d4cr2n3 (4cr2 N:754-925)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2364769Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2366353Superfamily b.3.8: Proteasome regulatory subunit Rpn2 C-terminal domain-like [345918] (1 family) (S)
    Topological similarity to carboxypeptidase (49466) noted in PubMed 22405010
  5. 2366354Family b.3.8.1: Proteasome regulatory subunit Rpn2, C-terminal domain-like [345960] (2 proteins)
  6. 2366358Protein Proteasome regulatory subunit Rpn2, C-terminal domain [346047] (1 species)
  7. 2366359Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346221] (2 PDB entries)
  8. 2366361Domain d4cr2n3: 4cr2 N:754-925 [345186]
    Other proteins in same PDB: d4cr21_, d4cr22_, d4cr23_, d4cr24_, d4cr25_, d4cr26_, d4cr27_, d4cr2a_, d4cr2b_, d4cr2c_, d4cr2d_, d4cr2e_, d4cr2f_, d4cr2g_, d4cr2h1, d4cr2h2, d4cr2h3, d4cr2i1, d4cr2i2, d4cr2i3, d4cr2j1, d4cr2j2, d4cr2j3, d4cr2k1, d4cr2k2, d4cr2k3, d4cr2l1, d4cr2l2, d4cr2l3, d4cr2m1, d4cr2m2, d4cr2m3, d4cr2n1, d4cr2n2, d4cr2o1, d4cr2o2, d4cr2p1, d4cr2p2, d4cr2q1, d4cr2q2, d4cr2r1, d4cr2r2, d4cr2s1, d4cr2s2, d4cr2t1, d4cr2t2, d4cr2u1, d4cr2u2, d4cr2v1, d4cr2v2, d4cr2w_, d4cr2x_, d4cr2y_, d4cr2z1, d4cr2z2, d4cr2z3

Details for d4cr2n3

PDB Entry: 4cr2 (more details), 7.7 Å

PDB Description: deep classification of a large cryo-em dataset defines the conformational landscape of the 26s proteasome
PDB Compounds: (N:) 26s proteasome regulatory subunit rpn2

SCOPe Domain Sequences for d4cr2n3:

Sequence, based on SEQRES records: (download)

>d4cr2n3 b.3.8.1 (N:754-925) Proteasome regulatory subunit Rpn2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tpttvigirgsdqaipkfqmncyakedafsyprmyeeasgkevekvatavlsttarakar
akktkkekgpneeekkkeheekekeretnkkgiketkendeefyknkysskpykvdnmtr
ilpqqsryisfikddrfvpvrkfkgnngvvvlrdrepkepvalietvrqmkd

Sequence, based on observed residues (ATOM records): (download)

>d4cr2n3 b.3.8.1 (N:754-925) Proteasome regulatory subunit Rpn2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tpttvigirgsdqaipkfqmncyakedafsyprmkysskpykvdnmtrilpqqsryisfi
kddrfvpvrkfkgnngvvvlrdrepkepvalietvrqmkd

SCOPe Domain Coordinates for d4cr2n3:

Click to download the PDB-style file with coordinates for d4cr2n3.
(The format of our PDB-style files is described here.)

Timeline for d4cr2n3:

  • d4cr2n3 is new in SCOPe 2.07-stable

View in 3D
Domains from other chains:
(mouse over for more information)
d4cr21_, d4cr22_, d4cr23_, d4cr24_, d4cr25_, d4cr26_, d4cr27_, d4cr2a_, d4cr2b_, d4cr2c_, d4cr2d_, d4cr2e_, d4cr2f_, d4cr2g_, d4cr2h1, d4cr2h2, d4cr2h3, d4cr2i1, d4cr2i2, d4cr2i3, d4cr2j1, d4cr2j2, d4cr2j3, d4cr2k1, d4cr2k2, d4cr2k3, d4cr2l1, d4cr2l2, d4cr2l3, d4cr2m1, d4cr2m2, d4cr2m3, d4cr2o1, d4cr2o2, d4cr2p1, d4cr2p2, d4cr2q1, d4cr2q2, d4cr2r1, d4cr2r2, d4cr2s1, d4cr2s2, d4cr2t1, d4cr2t2, d4cr2u1, d4cr2u2, d4cr2v1, d4cr2v2, d4cr2w_, d4cr2x_, d4cr2y_, d4cr2z1, d4cr2z2, d4cr2z3