Lineage for d4cr2m3 (4cr2 M:76-165)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870969Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2871288Protein Proteasome regulatory particle base subunit Rpt5, OB-fold domain [346081] (1 species)
  7. 2871289Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346300] (1 PDB entry)
  8. 2871290Domain d4cr2m3: 4cr2 M:76-165 [345183]
    Other proteins in same PDB: d4cr21_, d4cr22_, d4cr23_, d4cr24_, d4cr25_, d4cr26_, d4cr27_, d4cr2a_, d4cr2b_, d4cr2c_, d4cr2d1, d4cr2d2, d4cr2e_, d4cr2f_, d4cr2g_, d4cr2h1, d4cr2h2, d4cr2h3, d4cr2i1, d4cr2i2, d4cr2i3, d4cr2j1, d4cr2j2, d4cr2j3, d4cr2k1, d4cr2k2, d4cr2k3, d4cr2l1, d4cr2l2, d4cr2l3, d4cr2m1, d4cr2m2, d4cr2n1, d4cr2n2, d4cr2n3, d4cr2o1, d4cr2o2, d4cr2p1, d4cr2p2, d4cr2q1, d4cr2q2, d4cr2r1, d4cr2r2, d4cr2s1, d4cr2s2, d4cr2t1, d4cr2t2, d4cr2u1, d4cr2u2, d4cr2v1, d4cr2v2, d4cr2w_, d4cr2x_, d4cr2y_, d4cr2z1, d4cr2z2, d4cr2z3
    fragment; missing more than one-third of the common structure and/or sequence

Details for d4cr2m3

PDB Entry: 4cr2 (more details), 7.7 Å

PDB Description: deep classification of a large cryo-em dataset defines the conformational landscape of the 26s proteasome
PDB Compounds: (M:) 26s protease regulatory subunit 6a

SCOPe Domain Sequences for d4cr2m3:

Sequence, based on SEQRES records: (download)

>d4cr2m3 c.37.1.20 (M:76-165) Proteasome regulatory particle base subunit Rpt5, OB-fold domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pylvanvvevmdmneiedkensesttqggnvnldntavgkaavvktssrqtvflpmvglv
dpdklkpndlvgvnkdsylildtlpsefds

Sequence, based on observed residues (ATOM records): (download)

>d4cr2m3 c.37.1.20 (M:76-165) Proteasome regulatory particle base subunit Rpt5, OB-fold domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pylvanvvevvgkaavvktssrqtvflpmvglvdpdklkpndlvgvnkdsylildtlpse
fds

SCOPe Domain Coordinates for d4cr2m3:

Click to download the PDB-style file with coordinates for d4cr2m3.
(The format of our PDB-style files is described here.)

Timeline for d4cr2m3:

View in 3D
Domains from other chains:
(mouse over for more information)
d4cr21_, d4cr22_, d4cr23_, d4cr24_, d4cr25_, d4cr26_, d4cr27_, d4cr2a_, d4cr2b_, d4cr2c_, d4cr2d1, d4cr2d2, d4cr2e_, d4cr2f_, d4cr2g_, d4cr2h1, d4cr2h2, d4cr2h3, d4cr2i1, d4cr2i2, d4cr2i3, d4cr2j1, d4cr2j2, d4cr2j3, d4cr2k1, d4cr2k2, d4cr2k3, d4cr2l1, d4cr2l2, d4cr2l3, d4cr2n1, d4cr2n2, d4cr2n3, d4cr2o1, d4cr2o2, d4cr2p1, d4cr2p2, d4cr2q1, d4cr2q2, d4cr2r1, d4cr2r2, d4cr2s1, d4cr2s2, d4cr2t1, d4cr2t2, d4cr2u1, d4cr2u2, d4cr2v1, d4cr2v2, d4cr2w_, d4cr2x_, d4cr2y_, d4cr2z1, d4cr2z2, d4cr2z3