Lineage for d1hv9a2 (1hv9 A:4-251)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 491356Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 491357Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (13 families) (S)
  5. 491400Family c.68.1.5: UDP-glucose pyrophosphorylase [53461] (2 proteins)
  6. 491401Protein N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain [53462] (2 species)
  7. 491402Species Escherichia coli [TaxId:562] [53463] (3 PDB entries)
  8. 491403Domain d1hv9a2: 1hv9 A:4-251 [34518]
    Other proteins in same PDB: d1hv9a1, d1hv9b1

Details for d1hv9a2

PDB Entry: 1hv9 (more details), 2.1 Å

PDB Description: structure of e. coli glmu: analysis of pyrophosphorylase and acetyltransferase active sites

SCOP Domain Sequences for d1hv9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hv9a2 c.68.1.5 (A:4-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Escherichia coli}
namsvvilaagkgtrmysdlpkvlhtlagkamvqhvidaanelgaahvhlvyghggdllk
qalkddnlnwvlqaeqlgtghamqqaapffaddedilmlygdvplisvetlqrlrdakpq
ggiglltvklddptgygritrengkvtgivehkdatdeqrqiqeintgiliangadmkrw
lakltnnnaqgeyyitdiialayqegreivavhpqrlsevegvnnrlqlsrlervyqseq
aeklllag

SCOP Domain Coordinates for d1hv9a2:

Click to download the PDB-style file with coordinates for d1hv9a2.
(The format of our PDB-style files is described here.)

Timeline for d1hv9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hv9a1