Lineage for d4cr2j1 (4cr2 J:24-68)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2643821Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2645344Superfamily h.1.39: Proteasome regulatory subunits coiled coil regions [345933] (1 family) (S)
    Not a true superfamily
  5. 2645345Family h.1.39.1: Proteasome regulatory subunits coiled coil regions [345991] (3 proteins)
  6. 2645352Protein Proteasome regulatory subunits PAN/Rpt coiled coil regions [346134] (2 species)
  7. 2645353Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346447] (1 PDB entry)
  8. 2645356Domain d4cr2j1: 4cr2 J:24-68 [345172]
    Other proteins in same PDB: d4cr21_, d4cr22_, d4cr23_, d4cr24_, d4cr25_, d4cr26_, d4cr27_, d4cr2a_, d4cr2b_, d4cr2c_, d4cr2d_, d4cr2e_, d4cr2f_, d4cr2g_, d4cr2h2, d4cr2h3, d4cr2i2, d4cr2i3, d4cr2j2, d4cr2j3, d4cr2k2, d4cr2k3, d4cr2l2, d4cr2l3, d4cr2m2, d4cr2m3, d4cr2n1, d4cr2n2, d4cr2n3, d4cr2o1, d4cr2o2, d4cr2p1, d4cr2p2, d4cr2q1, d4cr2q2, d4cr2r1, d4cr2r2, d4cr2s1, d4cr2s2, d4cr2t1, d4cr2t2, d4cr2u1, d4cr2u2, d4cr2v1, d4cr2v2, d4cr2w_, d4cr2x_, d4cr2y_, d4cr2z1, d4cr2z2, d4cr2z3

Details for d4cr2j1

PDB Entry: 4cr2 (more details), 7.7 Å

PDB Description: deep classification of a large cryo-em dataset defines the conformational landscape of the 26s proteasome
PDB Compounds: (J:) 26s protease regulatory subunit 8 homolog

SCOPe Domain Sequences for d4cr2j1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cr2j1 h.1.39.1 (J:24-68) Proteasome regulatory subunits PAN/Rpt coiled coil regions {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eqkiqetelkirsktenvrrleaqrnalndkvrfikdelrllqep

SCOPe Domain Coordinates for d4cr2j1:

Click to download the PDB-style file with coordinates for d4cr2j1.
(The format of our PDB-style files is described here.)

Timeline for d4cr2j1:

View in 3D
Domains from other chains:
(mouse over for more information)
d4cr21_, d4cr22_, d4cr23_, d4cr24_, d4cr25_, d4cr26_, d4cr27_, d4cr2a_, d4cr2b_, d4cr2c_, d4cr2d_, d4cr2e_, d4cr2f_, d4cr2g_, d4cr2h1, d4cr2h2, d4cr2h3, d4cr2i1, d4cr2i2, d4cr2i3, d4cr2k1, d4cr2k2, d4cr2k3, d4cr2l1, d4cr2l2, d4cr2l3, d4cr2m1, d4cr2m2, d4cr2m3, d4cr2n1, d4cr2n2, d4cr2n3, d4cr2o1, d4cr2o2, d4cr2p1, d4cr2p2, d4cr2q1, d4cr2q2, d4cr2r1, d4cr2r2, d4cr2s1, d4cr2s2, d4cr2t1, d4cr2t2, d4cr2u1, d4cr2u2, d4cr2v1, d4cr2v2, d4cr2w_, d4cr2x_, d4cr2y_, d4cr2z1, d4cr2z2, d4cr2z3