Lineage for d1g9ra_ (1g9r A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 491356Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 491357Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (13 families) (S)
  5. 491394Family c.68.1.4: Galactosyltransferase LgtC [53458] (1 protein)
  6. 491395Protein Galactosyltransferase LgtC [53459] (1 species)
  7. 491396Species Neisseria meningitidis [TaxId:487] [53460] (3 PDB entries)
  8. 491398Domain d1g9ra_: 1g9r A: [34517]

Details for d1g9ra_

PDB Entry: 1g9r (more details), 2 Å

PDB Description: crystal structure of galactosyltransferase lgtc in complex with mn and udp-2f-galactose

SCOP Domain Sequences for d1g9ra_:

Sequence, based on SEQRES records: (download)

>d1g9ra_ c.68.1.4 (A:) Galactosyltransferase LgtC {Neisseria meningitidis}
mdivfaaddnyaaylcvaaksveaahpdteirfhvldagiseanraavaanlrggggnir
fidvnpedfagfplnirhisittyarlklgeyiadcdkvlyldidvlvrdsltplwdtdl
gdnwlgasidlfverqegykqkigmadgeyyfnagvllinlkkwrrhdifkmssewveqy
kdvmqyqdqdilnglfkggvcyansrfnfmptnyafmanwfasrhtdplyrdrtntvmpv
avshycgpakpwhrdctawgaerftelagslttvpeewrgkl

Sequence, based on observed residues (ATOM records): (download)

>d1g9ra_ c.68.1.4 (A:) Galactosyltransferase LgtC {Neisseria meningitidis}
mdivfaaddnyaaylcvaaksveaahpdteirfhvldagiseanraavaanlrggggnir
fidvnpedfagfplnirhisittyarlklgeyiadcdkvlyldidvlvrdsltplwdtdl
gdnwlgasidlfverqegykqkigmadgeyyfnagvllinlkkwrrhdifkmssewveqy
kdvmqyqdqdilnglfkggvcyansrfnfmptnyafmasrhtdplyrdrtntvmpvavsh
ycgpakpwhrdctawgaerftelagslttvpeewrgkl

SCOP Domain Coordinates for d1g9ra_:

Click to download the PDB-style file with coordinates for d1g9ra_.
(The format of our PDB-style files is described here.)

Timeline for d1g9ra_: