Lineage for d1g9ra_ (1g9r A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133191Family c.68.1.4: Galactosyltransferase LgtC [53458] (1 protein)
    automatically mapped to Pfam PF01501
  6. 2133192Protein Galactosyltransferase LgtC [53459] (1 species)
  7. 2133193Species Neisseria meningitidis [TaxId:487] [53460] (3 PDB entries)
    Uniprot Q93EK7
  8. 2133195Domain d1g9ra_: 1g9r A: [34517]
    complexed with acy, mn, upf

Details for d1g9ra_

PDB Entry: 1g9r (more details), 2 Å

PDB Description: crystal structure of galactosyltransferase lgtc in complex with mn and udp-2f-galactose
PDB Compounds: (A:) glycosyl transferase

SCOPe Domain Sequences for d1g9ra_:

Sequence, based on SEQRES records: (download)

>d1g9ra_ c.68.1.4 (A:) Galactosyltransferase LgtC {Neisseria meningitidis [TaxId: 487]}
mdivfaaddnyaaylcvaaksveaahpdteirfhvldagiseanraavaanlrggggnir
fidvnpedfagfplnirhisittyarlklgeyiadcdkvlyldidvlvrdsltplwdtdl
gdnwlgasidlfverqegykqkigmadgeyyfnagvllinlkkwrrhdifkmssewveqy
kdvmqyqdqdilnglfkggvcyansrfnfmptnyafmanwfasrhtdplyrdrtntvmpv
avshycgpakpwhrdctawgaerftelagslttvpeewrgkl

Sequence, based on observed residues (ATOM records): (download)

>d1g9ra_ c.68.1.4 (A:) Galactosyltransferase LgtC {Neisseria meningitidis [TaxId: 487]}
mdivfaaddnyaaylcvaaksveaahpdteirfhvldagiseanraavaanlrggggnir
fidvnpedfagfplnirhisittyarlklgeyiadcdkvlyldidvlvrdsltplwdtdl
gdnwlgasidlfverqegykqkigmadgeyyfnagvllinlkkwrrhdifkmssewveqy
kdvmqyqdqdilnglfkggvcyansrfnfmptnyafmasrhtdplyrdrtntvmpvavsh
ycgpakpwhrdctawgaerftelagslttvpeewrgkl

SCOPe Domain Coordinates for d1g9ra_:

Click to download the PDB-style file with coordinates for d1g9ra_.
(The format of our PDB-style files is described here.)

Timeline for d1g9ra_: