Lineage for d1ga8a_ (1ga8 A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
  4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (8 families) (S)
  5. 26538Family c.68.1.4: Galactosyltransferase LgtC [53458] (1 protein)
  6. 26539Protein Galactosyltransferase LgtC [53459] (1 species)
  7. 26540Species Neisseria meningitidis [TaxId:487] [53460] (2 PDB entries)
  8. 26541Domain d1ga8a_: 1ga8 A: [34516]

Details for d1ga8a_

PDB Entry: 1ga8 (more details), 2 Å

PDB Description: crystal structure of galacosyltransferase lgtc in complex with donor and acceptor sugar analogs.

SCOP Domain Sequences for d1ga8a_:

Sequence, based on SEQRES records: (download)

>d1ga8a_ c.68.1.4 (A:) Galactosyltransferase LgtC {Neisseria meningitidis}
mdivfaaddnyaaylcvaaksveaahpdteirfhvldagiseanraavaanlrggggnir
fidvnpedfagfplnirhisittyarlklgeyiadcdkvlyldidvlvrdsltplwdtdl
gdnwlgasidlfverqegykqkigmadgeyyfnagvllinlkkwrrhdifkmssewveqy
kdvmqyqdqdilnglfkggvcyansrfnfmptnyafmanwfasrhtdplyrdrtntvmpv
avshycgpakpwhrdctawgaerftelagslttvpeewrgkl

Sequence, based on observed residues (ATOM records): (download)

>d1ga8a_ c.68.1.4 (A:) Galactosyltransferase LgtC {Neisseria meningitidis}
mdivfaaddnyaaylcvaaksveaahpdteirfhvldagiseanraavaanlrggggnir
fidvnpedfagfplnirhisittyarlklgeyiadcdkvlyldidvlvrdsltplwdtdl
gdnwlgasidlfverqegykqkigmadgeyyfnagvllinlkkwrrhdifkmssewveqy
kdvmqyqdqdilnglfkggvcyansrfnfmptnyafmasrhtdplyrdrtntvmpvavsh
ycgpakpwhrdctawgaerftelagslttvpeewrgkl

SCOP Domain Coordinates for d1ga8a_:

Click to download the PDB-style file with coordinates for d1ga8a_.
(The format of our PDB-style files is described here.)

Timeline for d1ga8a_: