Lineage for d4cmpb4 (4cmp B:1137-1363)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2626563Fold e.80: CRISPR-associated endonuclease Cas9/Csn1, Protospace-adjacent motif (PAM)-interacting domain [345893] (1 superfamily)
    N-terminal part is structurally divergent wedge domain; middle domain is homologous to DNA gyrase B and Topoisomerase II; C-terminal domain appears to be Cas9-specific
  4. 2626564Superfamily e.80.1: CRISPR-associated endonuclease Cas9/Csn1, PAM-interacting (PI) domain [345926] (1 family) (S)
    Pfam PF16595
  5. 2626565Family e.80.1.1: CRISPR-associated endonuclease Cas9/Csn1, PAM-interacting (PI) domain [345982] (1 protein)
  6. 2626566Protein CRISPR-associated endonuclease Cas9/Csn1, PI domain [346119] (3 species)
  7. 2626571Species Streptococcus pyogenes [TaxId:301447] [346418] (2 PDB entries)
  8. 2626575Domain d4cmpb4: 4cmp B:1137-1363 [345151]
    Other proteins in same PDB: d4cmpa1, d4cmpa2, d4cmpa3, d4cmpb1, d4cmpb2, d4cmpb3
    automated match to d4cmpa4
    complexed with mg, so4

Details for d4cmpb4

PDB Entry: 4cmp (more details), 2.62 Å

PDB Description: Crystal structure of S. pyogenes Cas9
PDB Compounds: (B:) crispr-associated endonuclease cas9/csn1

SCOPe Domain Sequences for d4cmpb4:

Sequence, based on SEQRES records: (download)

>d4cmpb4 e.80.1.1 (B:1137-1363) CRISPR-associated endonuclease Cas9/Csn1, PI domain {Streptococcus pyogenes [TaxId: 301447]}
ptvaysvlvvakvekgkskklksvkellgitimerssfeknpidfleakgykevkkdlii
klpkyslfelengrkrmlasagelqkgnelalpskyvnflylashyeklkgspedneqkq
lfveqhkhyldeiieqisefskrviladanldkvlsaynkhrdkpireqaeniihlftlt
nlgapaafkyfdttidrkrytstkevldatlihqsitglyetridls

Sequence, based on observed residues (ATOM records): (download)

>d4cmpb4 e.80.1.1 (B:1137-1363) CRISPR-associated endonuclease Cas9/Csn1, PI domain {Streptococcus pyogenes [TaxId: 301447]}
ptvaysvlvvakvkellgitimerssfeknpidfleakkevkkdliiklpkyslfeleng
rkrmlasagelqkgnelalpskyvnflylashqlfveqhkhyldeiieqisefskrvila
danldkvlsaynkhrdkpireqaeniihlftltnlgapaafkyfdttidrkrytstkevl
datlihqsitglyetridls

SCOPe Domain Coordinates for d4cmpb4:

Click to download the PDB-style file with coordinates for d4cmpb4.
(The format of our PDB-style files is described here.)

Timeline for d4cmpb4: