Lineage for d4cmpb3 (4cmp B:773-902)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2535017Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 2535018Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 2535160Family d.4.1.8: HNH domain from CRISPR-associated protein Cas9 [345970] (1 protein)
    Homology to HNH nucleases noted in PubMed 21756346
    Pfam PF13395
  6. 2535161Protein CRISPR-associated endonuclease Cas9/Csn1, HNH domain [346090] (3 species)
  7. 2535166Species Streptococcus pyogenes [TaxId:301447] [346348] (2 PDB entries)
  8. 2535169Domain d4cmpb3: 4cmp B:773-902 [345150]
    Other proteins in same PDB: d4cmpa1, d4cmpa3, d4cmpa4, d4cmpb1, d4cmpb2, d4cmpb4
    automated match to d4cmpa2
    complexed with mg, so4

Details for d4cmpb3

PDB Entry: 4cmp (more details), 2.62 Å

PDB Description: Crystal structure of S. pyogenes Cas9
PDB Compounds: (B:) crispr-associated endonuclease cas9/csn1

SCOPe Domain Sequences for d4cmpb3:

Sequence, based on SEQRES records: (download)

>d4cmpb3 d.4.1.8 (B:773-902) CRISPR-associated endonuclease Cas9/Csn1, HNH domain {Streptococcus pyogenes [TaxId: 301447]}
gqknsrermkrieegikelgsqilkehpventqlqneklylyylqngrdmyvdqeldinr
lsdydvdhivpqsflkddsidnkvltrsdknrgksdnvpseevvkkmknywrqllnakli
tqrkfdnltk

Sequence, based on observed residues (ATOM records): (download)

>d4cmpb3 d.4.1.8 (B:773-902) CRISPR-associated endonuclease Cas9/Csn1, HNH domain {Streptococcus pyogenes [TaxId: 301447]}
gqknsrermkrieegikelpventqlqneklylyylqngrdmyvdqeldinrlsdydvdh
ivpqsflkddsidnkvltrknrgksdnvpseevvkkmknywrqllnaklitqrkfdnltk

SCOPe Domain Coordinates for d4cmpb3:

Click to download the PDB-style file with coordinates for d4cmpb3.
(The format of our PDB-style files is described here.)

Timeline for d4cmpb3: