Lineage for d4cmpb2 (4cmp B:59-713)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3012233Fold d.393: CRISPR-associated endonuclease Cas9/Csn1, Target recognition (REC) lobe [345890] (1 superfamily)
    Mostly helical, complex structure
  4. 3012234Superfamily d.393.1: CRISPR-associated endonuclease Cas9/Csn1, Target recognition (REC) lobe [345923] (1 family) (S)
    Pfam PF16593, Pfam PF13395
  5. 3012235Family d.393.1.1: CRISPR-associated endonuclease Cas9/Csn1, Target recognition (REC) lobe [345978] (1 protein)
  6. 3012236Protein CRISPR-associated endonuclease Cas9/Csn1, REC lobe [346112] (3 species)
  7. 3012241Species Streptococcus pyogenes [TaxId:301447] [346402] (2 PDB entries)
  8. 3012245Domain d4cmpb2: 4cmp B:59-713 [345149]
    Other proteins in same PDB: d4cmpa1, d4cmpa2, d4cmpa4, d4cmpb1, d4cmpb3, d4cmpb4
    automated match to d4cmpa3
    complexed with mg, so4

    missing some secondary structures that made up less than one-third of the common domain

Details for d4cmpb2

PDB Entry: 4cmp (more details), 2.62 Å

PDB Description: Crystal structure of S. pyogenes Cas9
PDB Compounds: (B:) crispr-associated endonuclease cas9/csn1

SCOPe Domain Sequences for d4cmpb2:

Sequence, based on SEQRES records: (download)

>d4cmpb2 d.393.1.1 (B:59-713) CRISPR-associated endonuclease Cas9/Csn1, REC lobe {Streptococcus pyogenes [TaxId: 301447]}
aeatrlkrtarrrytrrknricylqeifsnemakvddsffhrleesflveedkkherhpi
fgnivdevayhekyptiyhlrkklvdstdkadlrliylalahmikfrghfliegdlnpdn
sdvdklfiqlvqtynqlfeenpinasgvdakailsarlsksrrlenliaqlpgekknglf
gnlialslgltpnfksnfdlaedaklqlskdtydddldnllaqigdqyadlflaaknlsd
aillsdilrvnteitkaplsasmikrydehhqdltllkalvrqqlpekykeiffdqskng
yagyidggasqeefykfikpilekmdgteellvklnredllrkqrtfdngsiphqihlge
lhailrrqedfypflkdnrekiekiltfripyyvgplargnsrfawmtrkseetitpwnf
eevvdkgasaqsfiermtnfdknlpnekvlpkhsllyeyftvyneltkvkyvtegmrkpa
flsgeqkkaivdllfktnrkvtvkqlkedyfkkiecfdsveisgvedrfnaslgtyhdll
kiikdkdfldneenediledivltltlfedremieerlktyahlfddkvmkqlkrrrytg
wgrlsrklingirdkqsgktildflksdgfanrnfmqlihddsltfkediqkaqv

Sequence, based on observed residues (ATOM records): (download)

>d4cmpb2 d.393.1.1 (B:59-713) CRISPR-associated endonuclease Cas9/Csn1, REC lobe {Streptococcus pyogenes [TaxId: 301447]}
aeatrlkrtarrrytrrknricylqeifsnemakvddsffhrleehpifgnivdevayhe
kyptiyhlrkklvdstdkadlrliylalahmikfrghfliegdlnpdnsdvdklfiqlvq
tynqlfeenpinasgvdakailsarlsksrrlenliaqlpgekknglfgnlialslgltp
nfksnfdlaedaklqlskdtydddldnllaqigdqyadlflaaknlsdaillsdilrvte
itkaplsasmikrydehhqdltllkalvrqqlpekykeiffdqskngyagyidggasqee
fykfikpilekmdgteellvklnredllrkqrtfdngsiphqihlgelhailrrqedfyp
flkdnrekiekiltfrlpnekvlpkhsllyeyftvyneltkvflsgeqkkaivdllfktn
rkvtvkqlkedyfkfnaslgtyhdllkiikdkdfldneenediledivltltlfedremi
eerlktyahlfddkvmkqlkrrrytgwgrlsrklingirdkgktildflksdgfanrnfm
qlihddsltfkediqkaqv

SCOPe Domain Coordinates for d4cmpb2:

Click to download the PDB-style file with coordinates for d4cmpb2.
(The format of our PDB-style files is described here.)

Timeline for d4cmpb2: