Lineage for d4cmpb1 (4cmp B:4-58,B:718-764,B:908-1102)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2495021Family c.55.3.16: RuvC-like domain from CRISPR-associated protein Cas9 [345969] (1 protein)
    Homology to RuvC noted in PubMed 21756346
  6. 2495022Protein CRISPR-associated endonuclease Cas9/Csn1, RuvC-like domain [346086] (3 species)
  7. 2495027Species Streptococcus pyogenes [TaxId:301447] [346314] (2 PDB entries)
  8. 2495031Domain d4cmpb1: 4cmp B:4-58,B:718-764,B:908-1102 [345148]
    Other proteins in same PDB: d4cmpa2, d4cmpa3, d4cmpa4, d4cmpb2, d4cmpb3, d4cmpb4
    automated match to d4cmpa1
    complexed with mg, so4

Details for d4cmpb1

PDB Entry: 4cmp (more details), 2.62 Å

PDB Description: Crystal structure of S. pyogenes Cas9
PDB Compounds: (B:) crispr-associated endonuclease cas9/csn1

SCOPe Domain Sequences for d4cmpb1:

Sequence, based on SEQRES records: (download)

>d4cmpb1 c.55.3.16 (B:4-58,B:718-764,B:908-1102) CRISPR-associated endonuclease Cas9/Csn1, RuvC-like domain {Streptococcus pyogenes [TaxId: 301447]}
kysigldigtnsvgwavitdeykvpskkfkvlgntdrhsikknligallfdsgetXdslh
ehianlagspaikkgilqtvkvvdelvkvmgrhkpeniviemaXlseldkagfikrqlve
trqitkhvaqildsrmntkydendklirevkvitlksklvsdfrkdfqfykvreinnyhh
ahdaylnavvgtalikkypklesefvygdykvydvrkmiakseqeigkatakyffysnim
nffkteitlangeirkrplietngetgeivwdkgrdfatvrkvlsmpqvnivkktevqt

Sequence, based on observed residues (ATOM records): (download)

>d4cmpb1 c.55.3.16 (B:4-58,B:718-764,B:908-1102) CRISPR-associated endonuclease Cas9/Csn1, RuvC-like domain {Streptococcus pyogenes [TaxId: 301447]}
kysigldigtnsvgwavitdeykvpskkfkvlgntdrhsikknligallfdsgetXdslh
ehianlagspaikkgilqtvkvvdelvkvmgrhkpeniviemaXlseldkagfikrqlve
trqitkhvaqildsrmntkydendklirevkvitlksklvsdfrkdfqfykvreinnyhh
ahdaylnavvgtalikkypklesefvygdykvydvrkmiaksyffysnimnffkteitla
ngeirkrplietngetgeivwdkgrdfatvrkvlsmpqvnivkktevqt

SCOPe Domain Coordinates for d4cmpb1:

Click to download the PDB-style file with coordinates for d4cmpb1.
(The format of our PDB-style files is described here.)

Timeline for d4cmpb1: