SCOPe 2.08: Domain d4c9ab_: 4c9a B:

Lineage for d4c9ab_ (4c9a B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.9: Growth factor receptor domain [57184] (2 families)

5. Family g.3.9.0: automated matches [232406] (1 protein)
   not a true family

6. Protein automated matches [232407] (3 species)
   not a true protein

7. Species Xenopus (Silurana) tropicalis [TaxId:8364] [311364] (7 PDB entries)

8. Domain d4c9ab_: 4c9a B: [345126]
   automated match to d4cdke_

Details for d4c9ab_

PDB Entry: 4c9a, 2.4 Å

PDB Description: mouse znrf3 ectodomain in complex with xenopus rspo2 fu1-fu2 (seleno met) crystal form i

PDB Compounds: (B:) r-spondin-2

SCOPe Domain Sequences for d4c9ab_:

Sequence; same for both SEQRES and ATOM records:

>d4c9ab_ g.3.9.0 (B:) automated matches {Xenopus (Silurana) tropicalis [TaxId: 8364]}
ckgclscskdngclrcqpklffylrregmrqygeclqscppgyygvrgpdmnrcsrcrie
ncdscfsrdfcikcksgfyshkgqcfeecpegfaplddtmvcv

Timeline for d4c9ab_:

• d4c9ab_ first appeared in SCOPe 2.07