SCOPe 2.07: Domain d4c3hj_: 4c3h J:

Lineage for d4c3hj_ (4c3h J:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family)
   automatically mapped to Pfam PF01194

5. Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins)
   Zn-binding site is near the N-terminus

6. Protein RNA polymerase subunit RPB10 [46926] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (29 PDB entries)
   Uniprot P22139; part of multichain biological unit

8. Domain d4c3hj_: 4c3h J: [345099]
   Other proteins in same PDB: d4c3ha_, d4c3hb_, d4c3hc1, d4c3hc2, d4c3hd_, d4c3he1, d4c3he2, d4c3hf_, d4c3hg1, d4c3hg2, d4c3hh_, d4c3hi1, d4c3hi2, d4c3hk_, d4c3hl_, d4c3hm_, d4c3hn_
   complexed with zn

Details for d4c3hj_

PDB Entry: 4c3h, 3.27 Å

PDB Description: Structure of 14-subunit RNA polymerase I at 3.27 A resolution, crystal form C2-93

PDB Compounds: (J:) DNA-directed RNA polymerases I, II, and III subunit rpabc 5

SCOPe Domain Sequences for d4c3hj_:

Sequence; same for both SEQRES and ATOM records:

>d4c3hj_ a.4.11.1 (J:) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynplekr

Timeline for d4c3hj_:

• d4c3hj_ is new in SCOPe 2.07-stable
  
• d4c3hj_ appears in the current release, SCOPe 2.08