Lineage for d4c3hh_ (4c3h H:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2399889Family b.40.4.8: RNA polymerase subunit RBP8 [50321] (1 protein)
    duplication; contains tandem repeat of two incomplete OB-folds; forms a single barrel; n=8, S=10
    automatically mapped to Pfam PF03870
  6. 2399890Protein RNA polymerase subunit RBP8 [50322] (2 species)
  7. 2399891Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50323] (36 PDB entries)
    Uniprot P20436
  8. 2399904Domain d4c3hh_: 4c3h H: [345096]
    Other proteins in same PDB: d4c3ha_, d4c3hb_, d4c3hc1, d4c3hc2, d4c3hd_, d4c3he1, d4c3he2, d4c3hf_, d4c3hg1, d4c3hg2, d4c3hi1, d4c3hi2, d4c3hj_, d4c3hk_, d4c3hl_, d4c3hm_, d4c3hn_
    complexed with zn

Details for d4c3hh_

PDB Entry: 4c3h (more details), 3.27 Å

PDB Description: Structure of 14-subunit RNA polymerase I at 3.27 A resolution, crystal form C2-93
PDB Compounds: (H:) DNA-directed RNA polymerases I, II, and III subunit rpabc 3

SCOPe Domain Sequences for d4c3hh_:

Sequence, based on SEQRES records: (download)

>d4c3hh_ b.40.4.8 (H:) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtiass
lnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggll
mrlegnyrnlnnlkqenayllirr

Sequence, based on observed residues (ATOM records): (download)

>d4c3hh_ b.40.4.8 (H:) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtiass
lnatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggllmrlegnyrnl
nnlkqenayllirr

SCOPe Domain Coordinates for d4c3hh_:

Click to download the PDB-style file with coordinates for d4c3hh_.
(The format of our PDB-style files is described here.)

Timeline for d4c3hh_: