![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
![]() | Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) ![]() the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
![]() | Family a.143.1.2: RPB6 [55294] (2 proteins) |
![]() | Protein RPB6 [55295] (3 species) essential subunit of RNA polymerases I, II and III |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (31 PDB entries) Uniprot P20435; part of multichain biological unit |
![]() | Domain d4c3hf_: 4c3h F: [345093] Other proteins in same PDB: d4c3ha_, d4c3hb_, d4c3hc1, d4c3hc2, d4c3hd_, d4c3he1, d4c3he2, d4c3hg1, d4c3hg2, d4c3hh_, d4c3hi1, d4c3hi2, d4c3hj_, d4c3hk_, d4c3hl_, d4c3hm_, d4c3hn_ complexed with zn |
PDB Entry: 4c3h (more details), 3.27 Å
SCOPe Domain Sequences for d4c3hf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c3hf_ a.143.1.2 (F:) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} pedfqqheqirrktlkekaipkdqrattpymtkyerarilgtralqismnapvfvdlege tdplriamkelaekkiplvirrylpdgsfedwsveelivd
Timeline for d4c3hf_: