SCOPe 2.07: Domain d4c3he1: 4c3h E:1-143

Lineage for d4c3he1 (4c3h E:1-143)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family)

5. Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (2 proteins)

6. Protein Eukaryotic RPB5 N-terminal domain [53038] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (27 PDB entries)
   Uniprot P20434; part of multichain biological unit

8. Domain d4c3he1: 4c3h E:1-143 [345091]
   Other proteins in same PDB: d4c3ha_, d4c3hb_, d4c3hc1, d4c3hc2, d4c3hd_, d4c3he2, d4c3hf_, d4c3hg1, d4c3hg2, d4c3hh_, d4c3hi1, d4c3hi2, d4c3hj_, d4c3hk_, d4c3hl_, d4c3hm_, d4c3hn_
   complexed with zn

Details for d4c3he1

PDB Entry: 4c3h, 3.27 Å

PDB Description: Structure of 14-subunit RNA polymerase I at 3.27 A resolution, crystal form C2-93

PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III subunit rpabc 1

SCOPe Domain Sequences for d4c3he1:

Sequence; same for both SEQRES and ATOM records:

>d4c3he1 c.52.3.1 (E:1-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsf
qanpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsa
mklvpsippatietfneaalvvn

Timeline for d4c3he1:

• d4c3he1 is new in SCOPe 2.07-stable
  
• d4c3he1 appears in the current release, SCOPe 2.08