Lineage for d1fgxb_ (1fgx B:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 248321Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 248322Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (12 families) (S)
  5. 248331Family c.68.1.2: beta 1,4 galactosyltransferase (b4GalT1) [53452] (1 protein)
  6. 248332Protein beta 1,4 galactosyltransferase (b4GalT1) [53453] (1 species)
  7. 248333Species Cow (Bos taurus) [TaxId:9913] [53454] (11 PDB entries)
  8. 248351Domain d1fgxb_: 1fgx B: [34509]
    complexed with u5p

Details for d1fgxb_

PDB Entry: 1fgx (more details), 2.4 Å

PDB Description: crystal structure of the bovine beta 1,4 galactosyltransferase (b4galt1) catalytic domain complexed with ump

SCOP Domain Sequences for d1fgxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fgxb_ c.68.1.2 (B:) beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos taurus)}
sltacpeespllvgpmliefnipvdlklieqqnpkvklggrytpmdcisphkvaiiipfr
nrqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfv
fsdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpn
nywgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepnpqrfdriahtket
mlsdglnsltymvlevqryplytkitvdigtps

SCOP Domain Coordinates for d1fgxb_:

Click to download the PDB-style file with coordinates for d1fgxb_.
(The format of our PDB-style files is described here.)

Timeline for d1fgxb_: