Lineage for d4bq0d_ (4bq0 D:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470823Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2470824Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2472162Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2472163Protein automated matches [190151] (140 species)
    not a true protein
  7. 2472961Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [225932] (9 PDB entries)
  8. 2472975Domain d4bq0d_: 4bq0 D: [345084]
    automated match to d3a8ux_
    complexed with cl, plp

Details for d4bq0d_

PDB Entry: 4bq0 (more details), 1.77 Å

PDB Description: pseudomonas aeruginosa beta-alanine:pyruvate aminotransferase holoenzyme without divalent cations on dimer-dimer interface
PDB Compounds: (D:) beta-alanine--pyruvate transaminase

SCOPe Domain Sequences for d4bq0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bq0d_ c.67.1.0 (D:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
elnlrahwmpfsanrnfqkdpriivaaegswltddkgrkvydslsglwtcgaghsrkeiq
eavarqlgtldyspgfqyghplsfqlaekiagllpgelnhvfftgsgsecadtsikmara
ywrlkgqpqktkligrargyhgvnvagtslggiggnrkmfgqlmdvdhlphtlqpgmaft
rgmaqtggvelanellklielhdasniaavivepmsgsagvlvppvgylqrlreicdqhn
illifdevitafgrlgtysgaeyfgvtpdlmnvakqvtngavpmgaviasseiydtfmnq
alpehavefshgytysahpvacaaglaaldilardnlvqqsaelaphfekglhglqgakn
vidirncglagaiqiaprdgdptvrpfeagmklwqqgfyvrfggdtlqfgptfnarpeel
drlfdavgealngia

SCOPe Domain Coordinates for d4bq0d_:

Click to download the PDB-style file with coordinates for d4bq0d_.
(The format of our PDB-style files is described here.)

Timeline for d4bq0d_:

  • d4bq0d_ is new in SCOPe 2.07-stable