Lineage for d1fgxa_ (1fgx A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 319172Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 319173Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (13 families) (S)
  5. 319182Family c.68.1.2: beta 1,4 galactosyltransferase (b4GalT1) [53452] (1 protein)
  6. 319183Protein beta 1,4 galactosyltransferase (b4GalT1) [53453] (1 species)
  7. 319184Species Cow (Bos taurus) [TaxId:9913] [53454] (11 PDB entries)
  8. 319203Domain d1fgxa_: 1fgx A: [34508]

Details for d1fgxa_

PDB Entry: 1fgx (more details), 2.4 Å

PDB Description: crystal structure of the bovine beta 1,4 galactosyltransferase (b4galt1) catalytic domain complexed with ump

SCOP Domain Sequences for d1fgxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fgxa_ c.68.1.2 (A:) beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos taurus)}
ltacpeespllvgpmliefnipvdlklieqqnpkvklggrytpmdcisphkvaiiipfrn
rqehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvf
sdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnn
ywgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepnpqrfdriahtketm
lsdglnsltymvlevqryplytkitvdigtps

SCOP Domain Coordinates for d1fgxa_:

Click to download the PDB-style file with coordinates for d1fgxa_.
(The format of our PDB-style files is described here.)

Timeline for d1fgxa_: