SCOPe 2.05: Domain d1qgsa_: 1qgs A:

Lineage for d1qgsa_ (1qgs A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.1: Spore coat polysaccharide biosynthesis protein SpsA [53449] (1 protein)

6. Protein Spore coat polysaccharide biosynthesis protein SpsA [53450] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [53451] (5 PDB entries)

8. Domain d1qgsa_: 1qgs A: [34507]
   complexed with gol, mg, udp

Details for d1qgsa_

PDB Entry: 1qgs, 2 Å

PDB Description: udp-magnesium complex of spsa from bacillus subtilis

PDB Compounds: (A:) protein (spore coat polysaccharide biosynthesis protein spsa)

SCOPe Domain Sequences for d1qgsa_:

Sequence, based on SEQRES records:

>d1qgsa_ c.68.1.1 (A:) Spore coat polysaccharide biosynthesis protein SpsA {Bacillus subtilis [TaxId: 1423]}
pkvsvimtsynksdyvaksissilsqtfsdfelfimddnsneetlnvirpflndnrvrfy
qsdisgvkertektryaalinqaiemaegeyityatddniympdrllkmvreldthpeka
viysasktyhlnenrdivketvrpaaqvtwnapcaidhcsvmhrysvlekvkekfgsywd
espafyrigdarffwrvnhfypfypldeeldlnyitdqsihfqlfeleknefvrnlppqr
ncrelreslkklgmg

Sequence, based on observed residues (ATOM records):

>d1qgsa_ c.68.1.1 (A:) Spore coat polysaccharide biosynthesis protein SpsA {Bacillus subtilis [TaxId: 1423]}
pkvsvimtsynksdyvaksissilsqtfsdfelfimddnsneetlnvirpflndnrvrfy
qsdisgvkertektryaalinqaiemaegeyityatddniympdrllkmvreldthpeka
viysasktyhlndivketvrpaaqvtwnapcaidhcsvmhrysvlekvkekfgsywdesp
afyrigdarffwrvnhfypfypldeeldlnyitefvrnlppqrncrelreslkklgmg

Timeline for d1qgsa_:

• d1qgsa_ first appeared (with stable ids) in SCOP 1.55
  
• d1qgsa_ appears in SCOPe 2.04
  
• d1qgsa_ appears in SCOPe 2.06
  
• d1qgsa_ appears in the current release, SCOPe 2.08