Lineage for d4adyb1 (4ady B:309-753)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2332675Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2333279Family a.118.1.28: Proteasome/cyclosome repeat (PC repeat) [345954] (2 protein domains)
    Pfam PF01851
  6. 2333283Protein Proteasome regulatory subunit Rpn2, PC domain [346025] (1 species)
  7. 2333284Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346185] (2 PDB entries)
  8. 2333286Domain d4adyb1: 4ady B:309-753 [345065]
    Other proteins in same PDB: d4adya2, d4adya3
    automated match to d4adya1

Details for d4adyb1

PDB Entry: 4ady (more details), 2.7 Å

PDB Description: Crystal structure of 26S proteasome subunit Rpn2
PDB Compounds: (B:) 26s proteasome regulatory subunit rpn2

SCOPe Domain Sequences for d4adyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4adyb1 a.118.1.28 (B:309-753) Proteasome regulatory subunit Rpn2, PC domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
idigllnkskssldgkfslfhtavsvangfmhagttdnsfikanlpwlgkaqnwakftat
aslgvihkgnllegkkvmapylpgsrassrfikggslyglgliyagfgrdttdylkniiv
ensgtsgdedvdvllhgaslgiglaamgsanievyealkevlyndsatsgeaaalgmglc
mlgtgkpeaihdmftysqetqhgnitrglavglalinygrqeladdlitkmlasdesllr
yggaftialayagtgnnsavkrllhvavsdsnddvrraavialgfvllrdyttvprivql
lskshnahvrcgtafalgiacagkglqsaidvldpltkdpvdfvrqaamialsmiliqqt
eklnpqvadinknflsvitnkhqeglakfgacvaqgimnaggrnvtiqlenadtgtldtk
svvglvmfsqfwywfplahflslsf

SCOPe Domain Coordinates for d4adyb1:

Click to download the PDB-style file with coordinates for d4adyb1.
(The format of our PDB-style files is described here.)

Timeline for d4adyb1:

  • d4adyb1 is new in SCOPe 2.07-stable