SCOPe 2.08: Domain d4adya3: 4ady A:754-925

Lineage for d4adya3 (4ady A:754-925)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.8: Proteasome regulatory subunit Rpn2 C-terminal domain-like [345918] (1 family)
   Topological similarity to carboxypeptidase (49466) noted in PubMed 22405010

5. Family b.3.8.1: Proteasome regulatory subunit Rpn2, C-terminal domain-like [345960] (2 proteins)

6. Protein Proteasome regulatory subunit Rpn2, C-terminal domain [346047] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346221] (2 PDB entries)

8. Domain d4adya3: 4ady A:754-925 [345064]
   Other proteins in same PDB: d4adya1, d4adya2, d4adyb1

Details for d4adya3

PDB Entry: 4ady, 2.7 Å

PDB Description: crystal structure of 26s proteasome subunit rpn2

PDB Compounds: (A:) 26s proteasome regulatory subunit rpn2

SCOPe Domain Sequences for d4adya3:

Sequence, based on SEQRES records:

>d4adya3 b.3.8.1 (A:754-925) Proteasome regulatory subunit Rpn2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tpttvigirgsdqaipkfqmncyakedafsyprmyeeasgkevekvatavlsttarakar
akktkkekgpneeekkkeheekekeretnkkgiketkendeefyknkysskpykvdnmtr
ilpqqsryisfikddrfvpvrkfkgnngvvvlrdrepkepvalietvrqmkd

Sequence, based on observed residues (ATOM records):

>d4adya3 b.3.8.1 (A:754-925) Proteasome regulatory subunit Rpn2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tpttvigirgsdqaipkfqmncyakedafsyprmkysskpykvdnmtrilpqqsryisfi
kddrfvpvrkfkgnngvvvlrdrepkepvalietvrqmkd

Timeline for d4adya3:

• d4adya3 first appeared in SCOPe 2.07