Lineage for d4adya2 (4ady A:4-308)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2334625Superfamily a.118.28: Proteasome regulatory subunit Rpn2 N-terminal domain-like [345915] (1 family) (S)
  5. 2334626Family a.118.28.1: Proteasome regulatory subunit Rpn2, N-terminal domain-like [345956] (2 protein domains)
  6. 2334630Protein Proteasome regulatory subunit Rpn2, N-terminal domain [346041] (1 species)
  7. 2334631Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346204] (2 PDB entries)
  8. 2334632Domain d4adya2: 4ady A:4-308 [345063]
    Other proteins in same PDB: d4adya1, d4adya3, d4adyb1

Details for d4adya2

PDB Entry: 4ady (more details), 2.7 Å

PDB Description: Crystal structure of 26S proteasome subunit Rpn2
PDB Compounds: (A:) 26s proteasome regulatory subunit rpn2

SCOPe Domain Sequences for d4adya2:

Sequence, based on SEQRES records: (download)

>d4adya2 a.118.28.1 (A:4-308) Proteasome regulatory subunit Rpn2, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttaapllallrenqdsvktyalesinnvvdqlwseisnelpdiealydddtfsdremaal
iaskvyynlgeyesavkyalaakdrfdideksqfvetivsksiemyvqeaskqytkdeqf
ytkdiidpkltsifermiekclkaselklalgialegyrldiiesalkskldqdstsenv
kiinylltlaittvtnskfrssilrksfdflmnmpncdyltlnkvvvnlndaglalqlfk
klkeendeglsaqiafdlvssasqqlleilvteltaqgydpallnilsglptcdyyntfl
lnnkn

Sequence, based on observed residues (ATOM records): (download)

>d4adya2 a.118.28.1 (A:4-308) Proteasome regulatory subunit Rpn2, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttaapllallrenqdsvktyalesinnvvdqlwseisnelpdiealydddtfsdremaal
iaskvyynlgeyesavkyalaakdrfdideksqfvetivsksiemyvqeaskqytkdeqf
ytkdiidpkltsifermiekclkaselklalgialegyrldiiesalkskldqstsenvk
iinylltlaittvtnskfrssilrksfdflmnmpncdyltlnkvvvnlndaglalqlfkk
lkeendeglsaqiafdlvssasqqlleilvteltaqgydpallnilsglptcdyyntfll
nnkn

SCOPe Domain Coordinates for d4adya2:

Click to download the PDB-style file with coordinates for d4adya2.
(The format of our PDB-style files is described here.)

Timeline for d4adya2:

  • d4adya2 is new in SCOPe 2.07-stable

View in 3D
Domains from other chains:
(mouse over for more information)
d4adyb1