Lineage for d1qgqa_ (1qgq A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133077Family c.68.1.1: Spore coat polysaccharide biosynthesis protein SpsA [53449] (1 protein)
  6. 2133078Protein Spore coat polysaccharide biosynthesis protein SpsA [53450] (1 species)
  7. 2133079Species Bacillus subtilis [TaxId:1423] [53451] (5 PDB entries)
  8. 2133081Domain d1qgqa_: 1qgq A: [34506]
    complexed with gol, mg, mn, udp

Details for d1qgqa_

PDB Entry: 1qgq (more details), 1.5 Å

PDB Description: udp-manganese complex of spsa from bacillus subtilis
PDB Compounds: (A:) protein (spore coat polysaccharide biosynthesis protein spsa)

SCOPe Domain Sequences for d1qgqa_:

Sequence, based on SEQRES records: (download)

>d1qgqa_ c.68.1.1 (A:) Spore coat polysaccharide biosynthesis protein SpsA {Bacillus subtilis [TaxId: 1423]}
pkvsvimtsynksdyvaksissilsqtfsdfelfimddnsneetlnvirpflndnrvrfy
qsdisgvkertektryaalinqaiemaegeyityatddniympdrllkmvreldthpeka
viysasktyhlnenrdivketvrpaaqvtwnapcaidhcsvmhrysvlekvkekfgsywd
espafyrigdarffwrvnhfypfypldeeldlnyitdqsihfqlfeleknefvrnlppqr
ncrelreslkklgmg

Sequence, based on observed residues (ATOM records): (download)

>d1qgqa_ c.68.1.1 (A:) Spore coat polysaccharide biosynthesis protein SpsA {Bacillus subtilis [TaxId: 1423]}
pkvsvimtsynksdyvaksissilsqtfsdfelfimddnsneetlnvirpflndnrvrfy
qsdisgvkertektryaalinqaiemaegeyityatddniympdrllkmvreldthpeka
viysasktyhlndivketvrpaaqvtwnapcaidhcsvmhrysvlekvkekfgsywdesp
afyrigdarffwrvnhfypfypldeeldlnyitefvrnlppqrncrelreslkklgmg

SCOPe Domain Coordinates for d1qgqa_:

Click to download the PDB-style file with coordinates for d1qgqa_.
(The format of our PDB-style files is described here.)

Timeline for d1qgqa_: