Lineage for d3zg2a_ (3zg2 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (73 species)
    not a true protein
  7. 2332286Species Trypanosoma cruzi [TaxId:5693] [196511] (19 PDB entries)
  8. 2332309Domain d3zg2a_: 3zg2 A: [345052]
    automated match to d4uhia_
    complexed with hem, udo

Details for d3zg2a_

PDB Entry: 3zg2 (more details), 2.8 Å

PDB Description: Sterol 14 alpha-demethylase (CYP51) from Trypanosoma cruzi in complex with the pyridine inhibitor (S)-2-(4-chlorophenyl)-2-(pyridin-3-yl)-1- (4-(4-(trifluoromethyl)phenyl)piperazin-1-yl)ethanone (EPL-BS1246,UDO)
PDB Compounds: (A:) Sterol 14-alpha demethylase

SCOPe Domain Sequences for d3zg2a_:

Sequence, based on SEQRES records: (download)

>d3zg2a_ a.104.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
akktppvypvtvpflghivqfgknplefmqrckrdlksgvftisiggqrvtivgdphehs
rffsprneilsprevytimtpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiq
hevrkfmaenwkedegvinlledcgamiintacqclfgedlrkrlnarhfaqllskmess
lipaavfmpwllrlplpqsarcrearaelqkilgeiivarekeeaskdnntsdllggllk
avyrdgtrmslhevcgmivaamfagqhtstittswsmlhlmhpknkkwldklhkeidefp
aqlnydnvmdempfaercvresirrdppllmvmrmvkaevkvgsyvvpkgdiiacsplls
hhdeeafpnprlwdperdekvdgafigfgagvhkcigqkfallqvktilatafreydfql
lrdevpdpdyhtmvvgptlnqclvkytrkkk

Sequence, based on observed residues (ATOM records): (download)

>d3zg2a_ a.104.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
akktppvypvtvpflghivqfgknplefmqrckrdlksgvftisiggqrvtivgdphehs
rffsprneilsprevytimtpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiq
hevrkfmaenwkedegvinlledcgamiintacqclfgedlrkrlnarhfaqllskmess
lipaavfmpwllrlpqsarcrearaelqkilgeiivarekeeaskdnntsdllggllkav
yrdgtrmslhevcgmivaamfagqhtstittswsmlhlmhpknkkwldklhkeidefpaq
lnydnvmdempfaercvresirrdppllmvmrmvkaevkvgsyvvpkgdiiacspllshh
deeafpnprlwdperdekvdgafigfgagvhkcigqkfallqvktilatafreydfqllr
devpdpdyhtmvvgptlnqclvkytrkkk

SCOPe Domain Coordinates for d3zg2a_:

Click to download the PDB-style file with coordinates for d3zg2a_.
(The format of our PDB-style files is described here.)

Timeline for d3zg2a_:

  • d3zg2a_ is new in SCOPe 2.07-stable