SCOPe 2.08: Domain d3zefd2: 3zef D:170-355

Lineage for d3zefd2 (3zef D:170-355)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.29: U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain-like [345916] (1 family)
   C-terminal part of Pfam PF05282
   Structural similarity with VHS domains (48464) noted in PubMed 21764848, but no compelling evidence of homology

5. Family a.118.29.1: U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain-like [345957] (2 proteins)

6. Protein automated matches [346043] (1 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346206] (1 PDB entry)

8. Domain d3zefd2: 3zef D:170-355 [345051]
   Other proteins in same PDB: d3zefa1, d3zefb1, d3zefb2, d3zefb3, d3zefb4, d3zefb5, d3zefd1
   automated match to d4i43a2
   protein/RNA complex

Details for d3zefd2

PDB Entry: 3zef, 3.1 Å

PDB Description: Crystal structure of Prp8:Aar2 complex: second crystal form at 3.1 A resolution

PDB Compounds: (D:) A1 cistron-splicing factor AAR2

SCOPe Domain Sequences for d3zefd2:

Sequence, based on SEQRES records:

>d3zefd2 a.118.29.1 (D:170-355) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ddpahslnytvinfksreairpghemedfldksyylntvmlqgifknssnyfgelqfafl
namffgnygsslqwhamielicssatvpkhmldkldeilyyqiktlpeqysdillnervw
niclyssfqknslhntekimenkypellgkdneddaliygisdeerddeddehnptivgg
lyyqrp

Sequence, based on observed residues (ATOM records):

>d3zefd2 a.118.29.1 (D:170-355) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ddpahslnytvinfksreairpghemedfldksyylntvmlqgifknssnyfgelqfafl
namffgnygsslqwhamielicssatvpkhmldkldeilyyqiktlpeqysdillnervw
niclyssfqknslhntekimenkypellgkdliygehnptivgglyyqrp

Timeline for d3zefd2:

• d3zefd2 first appeared in SCOPe 2.07