Lineage for d3zefb2 (3zef B:1653-1825)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2882263Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2882264Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2882912Family c.52.1.0: automated matches [191531] (1 protein)
    not a true family
  6. 2882913Protein automated matches [190900] (3 species)
    not a true protein
  7. 2882921Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346309] (1 PDB entry)
  8. 2882922Domain d3zefb2: 3zef B:1653-1825 [345046]
    Other proteins in same PDB: d3zefa1, d3zefa2, d3zefb1, d3zefb3, d3zefb4, d3zefb5, d3zefd1, d3zefd2
    automated match to d4i43b3
    protein/RNA complex

Details for d3zefb2

PDB Entry: 3zef (more details), 3.1 Å

PDB Description: Crystal structure of Prp8:Aar2 complex: second crystal form at 3.1 A resolution
PDB Compounds: (B:) Pre-mRNA-splicing factor 8

SCOPe Domain Sequences for d3zefb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zefb2 c.52.1.0 (B:1653-1825) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lwqkihesivfdicqildgeldvlqiesvtketvhprksykmnssaaditmesvhewevs
kpsllhetndsfkglitnkmwfdvqlrygdydshdisryvrakfldyttdnvsmypsptg
vmigidlaynmydaygnwfnglkpliqnsmrtimkanpalyvlrerirkglqi

SCOPe Domain Coordinates for d3zefb2:

Click to download the PDB-style file with coordinates for d3zefb2.
(The format of our PDB-style files is described here.)

Timeline for d3zefb2: