Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) |
Family c.52.1.0: automated matches [191531] (1 protein) not a true family |
Protein automated matches [190900] (3 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346309] (1 PDB entry) |
Domain d3zefb2: 3zef B:1653-1825 [345046] Other proteins in same PDB: d3zefa1, d3zefa2, d3zefb1, d3zefb3, d3zefb4, d3zefb5, d3zefd1, d3zefd2 automated match to d4i43b3 protein/RNA complex |
PDB Entry: 3zef (more details), 3.1 Å
SCOPe Domain Sequences for d3zefb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zefb2 c.52.1.0 (B:1653-1825) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} lwqkihesivfdicqildgeldvlqiesvtketvhprksykmnssaaditmesvhewevs kpsllhetndsfkglitnkmwfdvqlrygdydshdisryvrakfldyttdnvsmypsptg vmigidlaynmydaygnwfnglkpliqnsmrtimkanpalyvlrerirkglqi
Timeline for d3zefb2:
View in 3D Domains from same chain: (mouse over for more information) d3zefb1, d3zefb3, d3zefb4, d3zefb5 |
View in 3D Domains from other chains: (mouse over for more information) d3zefa1, d3zefa2, d3zefd1, d3zefd2 |