Lineage for d3zefa2 (3zef A:169-355)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2334634Superfamily a.118.29: U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain-like [345916] (1 family) (S)
    C-terminal part of Pfam PF05282
    Structural similarity with VHS domains (48464) noted in PubMed 21764848, but no compelling evidence of homology
  5. 2334635Family a.118.29.1: U5 small nuclear riboprotein particle assembly factor Aar2 C-terminal domain-like [345957] (2 protein domains)
  6. 2334643Protein automated matches [346043] (1 species)
    not a true protein
  7. 2334644Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346206] (1 PDB entry)
  8. 2334645Domain d3zefa2: 3zef A:169-355 [345044]
    Other proteins in same PDB: d3zefa1, d3zefb1, d3zefb2, d3zefb3, d3zefb4, d3zefb5, d3zefd1
    automated match to d4i43a2
    protein/RNA complex

Details for d3zefa2

PDB Entry: 3zef (more details), 3.1 Å

PDB Description: Crystal structure of Prp8:Aar2 complex: second crystal form at 3.1 A resolution
PDB Compounds: (A:) A1 cistron-splicing factor AAR2

SCOPe Domain Sequences for d3zefa2:

Sequence, based on SEQRES records: (download)

>d3zefa2 a.118.29.1 (A:169-355) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eddpahslnytvinfksreairpghemedfldksyylntvmlqgifknssnyfgelqfaf
lnamffgnygsslqwhamielicssatvpkhmldkldeilyyqiktlpeqysdillnerv
wniclyssfqknslhntekimenkypellgkdneddaliygisdeerddeddehnptivg
glyyqrp

Sequence, based on observed residues (ATOM records): (download)

>d3zefa2 a.118.29.1 (A:169-355) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eddpahslnytvinfksreairpghemedfldksyylntvmlqgifknssnyfgelqfaf
lnamffgnygsslqwhamielicssatvpkhmldkldeilyyqiktlpeqysdillnerv
wniclyssfqknslhntekimenkypellgkddaliygddehnptivgglyyqrp

SCOPe Domain Coordinates for d3zefa2:

Click to download the PDB-style file with coordinates for d3zefa2.
(The format of our PDB-style files is described here.)

Timeline for d3zefa2:

  • d3zefa2 is new in SCOPe 2.07-stable