Lineage for d3zefa1 (3zef A:2-153)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2825821Fold b.182: U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain-like [345889] (1 superfamily)
    10-stranded mixed beta sandwich with 3 helices surrounding the upper rim
  4. 2825822Superfamily b.182.1: U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain-like [345922] (1 family) (S)
    N-terminal part of Pfam PF05282
  5. 2825823Family b.182.1.1: U5 small nuclear riboprotein particle assembly factor Aar2 N-terminal domain-like [345967] (2 proteins)
  6. 2825966Protein automated matches [346066] (1 species)
    not a true protein
  7. 2825967Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346270] (1 PDB entry)
  8. 2825968Domain d3zefa1: 3zef A:2-153 [345043]
    Other proteins in same PDB: d3zefa2, d3zefb1, d3zefb2, d3zefb3, d3zefb4, d3zefb5, d3zefd2
    automated match to d4i43a1
    protein/RNA complex

Details for d3zefa1

PDB Entry: 3zef (more details), 3.1 Å

PDB Description: Crystal structure of Prp8:Aar2 complex: second crystal form at 3.1 A resolution
PDB Compounds: (A:) A1 cistron-splicing factor AAR2

SCOPe Domain Sequences for d3zefa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zefa1 b.182.1.1 (A:2-153) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ntvpftsapievtigidqysfnvkenqpfhgikdipighvhvihfqhadnssmrygywfd
crmgnfyiqydpkdglykmmeerdgakfenivhnfkerqmmvsypkideddtwynltefv
qmdkirkivrkdenqfsyvdssmttvqenell

SCOPe Domain Coordinates for d3zefa1:

Click to download the PDB-style file with coordinates for d3zefa1.
(The format of our PDB-style files is described here.)

Timeline for d3zefa1: