Lineage for d1ordb2 (1ord B:108-569)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 247822Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 247823Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 248308Family c.67.1.5: Ornithine decarboxylase major domain [53444] (1 protein)
  6. 248309Protein Ornithine decarboxylase major domain [53445] (1 species)
  7. 248310Species Lactobacillus sp., strain 30a [TaxId:1591] [53446] (2 PDB entries)
  8. 248313Domain d1ordb2: 1ord B:108-569 [34504]
    Other proteins in same PDB: d1orda1, d1orda3, d1ordb1, d1ordb3
    complexed with plp

Details for d1ordb2

PDB Entry: 1ord (more details), 3 Å

PDB Description: crystallographic structure of a plp-dependent ornithine decarboxylase from lactobacillus 30a to 3.1 angstroms resolution

SCOP Domain Sequences for d1ordb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ordb2 c.67.1.5 (B:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a}
ppffkslkeyvsrgliqfdcpghqggqyyrkhpagrefydffgetvfradlcnadvalgd
llihegpavaaekhaarvynadktyfvlggssnanntvtsalvsngdlvlfdrnnhksvy
nsalamaggrpvylqtnrnpygfiggiydsdfdekkirelaakvdperakwkrpfrlavi
qlgtydgtiynahevvkrighlcdyiefdsawvgyeqfipmmrnssplliddlgpedpgi
ivvqsvhkqqagfsqtsqihkkdshikgqlrycdhkhfnnsfnlfmstspfypmyaaldv
naamqegeagrklwhdllittiearkklikagsmfrpfvppvvngkkwedgdtedmanni
dywrfekgakwhayegygdnqyyvdpnkfmlttpginpetgdyedfgvpativanylrdh
giipeksdlnsilflmtpaetpakmnnlitqllqlqrlieed

SCOP Domain Coordinates for d1ordb2:

Click to download the PDB-style file with coordinates for d1ordb2.
(The format of our PDB-style files is described here.)

Timeline for d1ordb2: