Lineage for d1ordb2 (1ord B:108-569)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896534Family c.67.1.5: Ornithine decarboxylase major domain [53444] (1 protein)
    automatically mapped to Pfam PF01276
  6. 2896535Protein Ornithine decarboxylase major domain [53445] (1 species)
  7. 2896536Species Lactobacillus sp., strain 30a [TaxId:1591] [53446] (2 PDB entries)
  8. 2896538Domain d1ordb2: 1ord B:108-569 [34504]
    Other proteins in same PDB: d1orda1, d1orda3, d1ordb1, d1ordb3
    complexed with plp

Details for d1ordb2

PDB Entry: 1ord (more details), 3 Å

PDB Description: crystallographic structure of a plp-dependent ornithine decarboxylase from lactobacillus 30a to 3.1 angstroms resolution
PDB Compounds: (B:) ornithine decarboxylase

SCOPe Domain Sequences for d1ordb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ordb2 c.67.1.5 (B:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]}
ppffkslkeyvsrgliqfdcpghqggqyyrkhpagrefydffgetvfradlcnadvalgd
llihegpavaaekhaarvynadktyfvlggssnanntvtsalvsngdlvlfdrnnhksvy
nsalamaggrpvylqtnrnpygfiggiydsdfdekkirelaakvdperakwkrpfrlavi
qlgtydgtiynahevvkrighlcdyiefdsawvgyeqfipmmrnssplliddlgpedpgi
ivvqsvhkqqagfsqtsqihkkdshikgqlrycdhkhfnnsfnlfmstspfypmyaaldv
naamqegeagrklwhdllittiearkklikagsmfrpfvppvvngkkwedgdtedmanni
dywrfekgakwhayegygdnqyyvdpnkfmlttpginpetgdyedfgvpativanylrdh
giipeksdlnsilflmtpaetpakmnnlitqllqlqrlieed

SCOPe Domain Coordinates for d1ordb2:

Click to download the PDB-style file with coordinates for d1ordb2.
(The format of our PDB-style files is described here.)

Timeline for d1ordb2: