Lineage for d3wj7a_ (3wj7 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2430344Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2430345Protein automated matches [190069] (243 species)
    not a true protein
  7. 2431250Species Gluconobacter oxydans [TaxId:290633] [271544] (3 PDB entries)
  8. 2431261Domain d3wj7a_: 3wj7 A: [345036]
    automated match to d5tqma_
    complexed with hg

Details for d3wj7a_

PDB Entry: 3wj7 (more details), 2.6 Å

PDB Description: Crystal structure of gox2253
PDB Compounds: (A:) Putative oxidoreductase

SCOPe Domain Sequences for d3wj7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wj7a_ c.2.1.0 (A:) automated matches {Gluconobacter oxydans [TaxId: 290633]}
ndvtlvtgatgfvgsavarvleerghrlrllvrptsdrsniaelnaelavgdlsdpdtla
palkgvkilfhvaadyrlwvpdpetmmkanvegtrnlmlaaleagvekiiycssvaalgl
rsdgvpadettpvsesqvigiyklskyraeqevlrlireknlpaiivnpstpvgprdikp
tptgqmildcasgnmpayvetglnivhvddvaeghalalergkigekyilggenimlgdl
frmvsqiagvkppavklkqswlypvalvsewlargfgieprvtretlamskklmffssdk
akkelgyaprpardavtdaiawfrqhgrmk

SCOPe Domain Coordinates for d3wj7a_:

Click to download the PDB-style file with coordinates for d3wj7a_.
(The format of our PDB-style files is described here.)

Timeline for d3wj7a_:

  • d3wj7a_ is new in SCOPe 2.07-stable