Lineage for d1orda2 (1ord A:108-569)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 73100Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
  4. 73101Superfamily c.67.1: PLP-dependent transferases [53383] (5 families) (S)
  5. 73501Family c.67.1.5: Ornithine decarboxylase major domain [53444] (1 protein)
  6. 73502Protein Ornithine decarboxylase major domain [53445] (1 species)
  7. 73503Species Lactobacillus sp., strain 30a [TaxId:1591] [53446] (2 PDB entries)
  8. 73505Domain d1orda2: 1ord A:108-569 [34503]
    Other proteins in same PDB: d1orda1, d1orda3, d1ordb1, d1ordb3

Details for d1orda2

PDB Entry: 1ord (more details), 3 Å

PDB Description: crystallographic structure of a plp-dependent ornithine decarboxylase from lactobacillus 30a to 3.1 angstroms resolution

SCOP Domain Sequences for d1orda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1orda2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a}
ppffkslkeyvsrgliqfdcpghqggqyyrkhpagrefydffgetvfradlcnadvalgd
llihegpavaaekhaarvynadktyfvlggssnanntvtsalvsngdlvlfdrnnhksvy
nsalamaggrpvylqtnrnpygfiggiydsdfdekkirelaakvdperakwkrpfrlavi
qlgtydgtiynahevvkrighlcdyiefdsawvgyeqfipmmrnssplliddlgpedpgi
ivvqsvhkqqagfsqtsqihkkdshikgqlrycdhkhfnnsfnlfmstspfypmyaaldv
naamqegeagrklwhdllittiearkklikagsmfrpfvppvvngkkwedgdtedmanni
dywrfekgakwhayegygdnqyyvdpnkfmlttpginpetgdyedfgvpativanylrdh
giipeksdlnsilflmtpaetpakmnnlitqllqlqrlieed

SCOP Domain Coordinates for d1orda2:

Click to download the PDB-style file with coordinates for d1orda2.
(The format of our PDB-style files is described here.)

Timeline for d1orda2: