SCOPe 2.08: Domain d3urma_: 3urm A:

Lineage for d3urma_ (3urm A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (77 species)
   not a true protein

7. Species Agrobacterium tumefaciens [TaxId:176299] [225916] (8 PDB entries)

8. Domain d3urma_: 3urm A: [345022]
   automated match to d4wwha_
   complexed with gal

Details for d3urma_

PDB Entry: 3urm, 1.8 Å

PDB Description: crystal structure of the periplasmic sugar binding protein chve

PDB Compounds: (A:) Multiple sugar-binding periplasmic receptor ChvE

SCOPe Domain Sequences for d3urma_:

Sequence; same for both SEQRES and ATOM records:

>d3urma_ c.93.1.0 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
dkgsvgiamptkssarwiddgnnivkqlqeagyktdlqyadddipnqlsqienmvtkgvk
vlviasidgttlsdvlkqageqgikviaydrlirnsgdvsyyatfdnfqvgvlqatsitd
klglkdgkgpfnielfggspddnnafffydgamsvlkpyidsgklvvksgqmgmdkvgtl
rwdpataqarmdnllsayytdakvdavlspydglsigiisslkgvgygtkdqplpvvsgq
daevpsvksiiageqystifkdtrelakvtvnmvnavmegkepevndtktyengvkvvps
yllkpvavtkenykqvlvdggyykedqlk

Timeline for d3urma_:

• d3urma_ first appeared in SCOPe 2.07