Lineage for d3udwd_ (3udw D:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1180 PDB entries)
  8. 2356877Domain d3udwd_: 3udw D: [345020]
    automated match to d5b21a_
    complexed with nag

Details for d3udwd_

PDB Entry: 3udw (more details), 2.9 Å

PDB Description: Crystal structure of the immunoreceptor TIGIT in complex with Poliovirus receptor (PVR/CD155/necl-5) D1 domain
PDB Compounds: (D:) poliovirus receptor

SCOPe Domain Sequences for d3udwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3udwd_ b.1.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvvvqaptqvpgflgdsvtlpcylqvpnmevthvsqltwarhgesgsmavfhqtqgpsys
eskrlefvaarlgaelrnaslrmfglrvedegnytclfvtfpqgsrsvdiwlrvl

SCOPe Domain Coordinates for d3udwd_:

Click to download the PDB-style file with coordinates for d3udwd_.
(The format of our PDB-style files is described here.)

Timeline for d3udwd_:

  • d3udwd_ is new in SCOPe 2.07-stable