Lineage for d1c4ka2 (1c4k A:108-569)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 125751Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
  4. 125752Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 126159Family c.67.1.5: Ornithine decarboxylase major domain [53444] (1 protein)
  6. 126160Protein Ornithine decarboxylase major domain [53445] (1 species)
  7. 126161Species Lactobacillus sp., strain 30a [TaxId:1591] [53446] (2 PDB entries)
  8. 126162Domain d1c4ka2: 1c4k A:108-569 [34502]
    Other proteins in same PDB: d1c4ka1, d1c4ka3

Details for d1c4ka2

PDB Entry: 1c4k (more details), 2.7 Å

PDB Description: ornithine decarboxylase mutant (gly121tyr)

SCOP Domain Sequences for d1c4ka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a}
ppffkslkeyvsryliqfdcpghqggqyyrkhpagrefydffgetvfradlcnadvalgd
llihegpavaaekhaarvynadktyfvlggssnanntvtsalvsngdlvlfdrnnhksvy
nsalamaggrpvylqtnrnpygfiggiydsdfdekkirelaakvdperakwkrpfrlavi
qlgtydgtiynahevvkrighlcdyiefdsawvgyeqfipmmrnssplliddlgpedpgi
ivvqsvhkqqagfsqtsqihkkdshikgqlrycdhkhfnnsfnlfmstspfypmyaaldv
naamqegeagrklwhdllittiearkklikagsmfrpfvppvvngkkwedgdtedmanni
dywrfekgakwhayegygdnqyyvdpnkfmlttpginpetgdyedfgvpativanylrdh
giipeksdlnsilflmtpaetpakmnnlitqllqlqrlieed

SCOP Domain Coordinates for d1c4ka2:

Click to download the PDB-style file with coordinates for d1c4ka2.
(The format of our PDB-style files is described here.)

Timeline for d1c4ka2: