Lineage for d3udwc_ (3udw C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758001Domain d3udwc_: 3udw C: [345019]
    automated match to d5b21a_
    complexed with nag

Details for d3udwc_

PDB Entry: 3udw (more details), 2.9 Å

PDB Description: crystal structure of the immunoreceptor tigit in complex with poliovirus receptor (pvr/cd155/necl-5) d1 domain
PDB Compounds: (C:) poliovirus receptor

SCOPe Domain Sequences for d3udwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3udwc_ b.1.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvvvqaptqvpgflgdsvtlpcylqvpnmevthvsqltwarhgesgsmavfhqtqgpsys
eskrlefvaarlgaelrnaslrmfglrvedegnytclfvtfpqgsrsvdiwlrvla

SCOPe Domain Coordinates for d3udwc_:

Click to download the PDB-style file with coordinates for d3udwc_.
(The format of our PDB-style files is described here.)

Timeline for d3udwc_: