Lineage for d3txna1 (3txn A:38-322)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333768Superfamily a.118.8: TPR-like [48452] (10 families) (S)
  5. 2334044Family a.118.8.9: TPR-like repeats from PCI (proteasome / COP9 signalosome / eIF3) domains [345951] (10 protein domains)
    N-terminal part of Pfam PF06272
    Described in PubMed 15180986 as 'HAM (HEAT analagous motif) domain'
    Probably homologous to TPR rather than HEAT, based on PubMed 15790418
  6. 2334066Protein Proteasome regulatory subunit Rpn6, N-terminal domain [346036] (2 species)
  7. 2334069Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [346199] (2 PDB entries)
  8. 2334070Domain d3txna1: 3txn A:38-322 [345013]
    Other proteins in same PDB: d3txna2
    automated match to d3txma1
    complexed with gol, so4

Details for d3txna1

PDB Entry: 3txn (more details), 2.5 Å

PDB Description: Crystal structure of Rpn6 from Drosophila melanogaster, native data
PDB Compounds: (A:) 26S proteasome regulatory complex subunit p42B

SCOPe Domain Sequences for d3txna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3txna1 a.118.8.9 (A:38-322) Proteasome regulatory subunit Rpn6, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ndeeririkeqgilqqgelykqegkakeladlikvtrpflssiskakaaklvrslvdmfl
dmdagtgievqlckdciewakqekrtflrqslearlialyfdtalytealalgaqllrel
kklddknllvevqllesktyhalsnlpkaraaltsarttanaiycppkvqgaldlqsgil
haaderdfktafsyfyeafegfdsvdsvkaltslkymllckimlgqsddvnqlvsgklai
tysgrdidamksvaeashkrsladfqaalkeykkelaedvivqah

SCOPe Domain Coordinates for d3txna1:

Click to download the PDB-style file with coordinates for d3txna1.
(The format of our PDB-style files is described here.)

Timeline for d3txna1:

  • d3txna1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d3txna2