Lineage for d3txma2 (3txm A:323-390)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2306772Family a.4.5.47: C-terminal part of PCI (proteasome COP9/signalosome eIF3) domains (PINT motif) [109671] (11 protein domains)
    Pfam PF01399
    some members have long C-terminal tail with helix
  6. 2306800Protein Proteasome regulatory subunit Rpn6, C-terminal domain [346017] (2 species)
  7. 2306803Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [346162] (2 PDB entries)
  8. 2306805Domain d3txma2: 3txm A:323-390 [345012]
    Other proteins in same PDB: d3txma1
    complexed with gd3, so4

Details for d3txma2

PDB Entry: 3txm (more details), 3 Å

PDB Description: Crystal structure of Rpn6 from Drosophila melanogaster, Gd(3+) complex
PDB Compounds: (A:) 26S proteasome regulatory complex subunit p42B

SCOPe Domain Sequences for d3txma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3txma2 a.4.5.47 (A:323-390) Proteasome regulatory subunit Rpn6, C-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
lgtlydtmleqnlcriiepysrvqvahvaesiqlpmpqvekklsqmildkkfsgildqge
gvlivfee

SCOPe Domain Coordinates for d3txma2:

Click to download the PDB-style file with coordinates for d3txma2.
(The format of our PDB-style files is described here.)

Timeline for d3txma2:

  • d3txma2 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d3txma1