SCOPe 2.08: Domain d3tp2b2: 3tp2 B:133-227

Lineage for d3tp2b2 (3tp2 B:133-227)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (70 proteins)
   Pfam PF00076
   Pfam PF13893

6. Protein Pre-mRNA splicing factor Cwc2 / Cwf2 / Prp3, RRM domain [346093] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [346356] (3 PDB entries)

8. Domain d3tp2b2: 3tp2 B:133-227 [345008]
   Other proteins in same PDB: d3tp2a1, d3tp2b1
   automated match to d3u1ma2
   complexed with na, zn

Details for d3tp2b2

PDB Entry: 3tp2, 2.4 Å

PDB Description: Crystal Structure of the Splicing Factor Cwc2 from yeast

PDB Compounds: (B:) Pre-mRNA-splicing factor CWC2

SCOPe Domain Sequences for d3tp2b2:

Sequence; same for both SEQRES and ATOM records:

>d3tp2b2 d.58.7.1 (B:133-227) Pre-mRNA splicing factor Cwc2 / Cwf2 / Prp3, RRM domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
knktlyvggidgalnskhlkpaqiesrirfvfsrlgdidriryveskncgfvkfkyqana
efakeamsnqtlllpsdkewddrregtgllvkwan

Timeline for d3tp2b2:

• d3tp2b2 first appeared in SCOPe 2.07