Lineage for d3tp2b1 (3tp2 B:3-115)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038401Fold g.66: CCCH zinc finger [90228] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 3038402Superfamily g.66.1: CCCH zinc finger [90229] (2 families) (S)
  5. 3038418Family g.66.1.2: Pre-mRNA splicing factor Cwc2 / Cwf2 / Prp3, zinc finger domain [345986] (1 protein)
    Pfam PF16131; Zinc finger is surrounded by additional short helices and loops
  6. 3038419Protein Pre-mRNA splicing factor Cwc2 / Cwf2 / Prp3, zinc finger domain [346127] (2 species)
  7. 3038420Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [346437] (3 PDB entries)
  8. 3038424Domain d3tp2b1: 3tp2 B:3-115 [345007]
    Other proteins in same PDB: d3tp2a2, d3tp2b2
    automated match to d3u1ma1
    complexed with na, zn

Details for d3tp2b1

PDB Entry: 3tp2 (more details), 2.4 Å

PDB Description: Crystal Structure of the Splicing Factor Cwc2 from yeast
PDB Compounds: (B:) Pre-mRNA-splicing factor CWC2

SCOPe Domain Sequences for d3tp2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tp2b1 g.66.1.2 (B:3-115) Pre-mRNA splicing factor Cwc2 / Cwf2 / Prp3, zinc finger domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
swrdksakvqvkeselpssipaqtgltfniwynkwsqgfagntrfvspfalqpqlhsgkt
rgdndgqlffclffakgmcclgpkceylhhipdeedigklalrtevldcfgre

SCOPe Domain Coordinates for d3tp2b1:

Click to download the PDB-style file with coordinates for d3tp2b1.
(The format of our PDB-style files is described here.)

Timeline for d3tp2b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tp2b2