Class g: Small proteins [56992] (100 folds) |
Fold g.66: CCCH zinc finger [90228] (1 superfamily) metal(zinc)-bound alpha+beta fold |
Superfamily g.66.1: CCCH zinc finger [90229] (2 families) |
Family g.66.1.2: Pre-mRNA splicing factor Cwc2 / Cwf2 / Prp3, zinc finger domain [345986] (1 protein) Pfam PF16131; Zinc finger is surrounded by additional short helices and loops |
Protein Pre-mRNA splicing factor Cwc2 / Cwf2 / Prp3, zinc finger domain [346127] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [346437] (3 PDB entries) |
Domain d3tp2b1: 3tp2 B:3-115 [345007] Other proteins in same PDB: d3tp2a2, d3tp2b2 automated match to d3u1ma1 complexed with na, zn |
PDB Entry: 3tp2 (more details), 2.4 Å
SCOPe Domain Sequences for d3tp2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tp2b1 g.66.1.2 (B:3-115) Pre-mRNA splicing factor Cwc2 / Cwf2 / Prp3, zinc finger domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} swrdksakvqvkeselpssipaqtgltfniwynkwsqgfagntrfvspfalqpqlhsgkt rgdndgqlffclffakgmcclgpkceylhhipdeedigklalrtevldcfgre
Timeline for d3tp2b1: