Lineage for d1b8gb_ (1b8g B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26196Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
  4. 26197Superfamily c.67.1: PLP-dependent transferases [53383] (5 families) (S)
  5. 26419Family c.67.1.4: omega-Amino acid:pyruvate aminotransferase-like [53417] (11 proteins)
  6. 26420Protein 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) [53440] (1 species)
  7. 26421Species Apple (Malus domestica) [TaxId:3750] [53441] (1 PDB entry)
  8. 26423Domain d1b8gb_: 1b8g B: [34500]

Details for d1b8gb_

PDB Entry: 1b8g (more details), 2.37 Å

PDB Description: 1-aminocyclopropane-1-carboxylate synthase

SCOP Domain Sequences for d1b8gb_:

Sequence, based on SEQRES records: (download)

>d1b8gb_ c.67.1.4 (B:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica)}
mlsrnatfnshgqdssyflgwqeyeknpyhevhntngiiqmglaenqlcfdlleswlakn
peaaafkkngesifaelalfqdyhglpafkkamvdfmaeirgnkvtfdpnhlvltagats
anetfifcladpgeavliptpyypgfdrdlkwrtgveivpihctssngfqitetaleeay
qeaekrnlrvkgvlvtnpsnplgttmtrnelylllsfvedkgihlisdeiysgtafssps
fisvmevlkdrncdensevwqrvhvvyslskdlglpgfrvgaiysnddmvvaaatkmssf
glvssqtqhllsamlsdkkltknyiaenhkrlkqrqkklvsglqksgisclngnaglfcw
vdmrhllrsntfeaemelwkkivyevhlnispgsschctepgwfrvcfanlpertldlam
qrlkafvge

Sequence, based on observed residues (ATOM records): (download)

>d1b8gb_ c.67.1.4 (B:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica)}
mlsrnatfnsssyflgwqeyeknpyhevhntngiiqmglaenqlcfdlleswlaknpeaa
afkkngesifaelalfqdyhglpafkkamvdfmaeirgnkvtfdpnhlvltagatsanet
fifcladpgeavliptpyypgfdrdlkwrtgveivpihctssngfqitetaleeayqeae
krnlrvkgvlvtnpsnplgttmtrnelylllsfvedkgihlisdeiysgtafsspsfisv
mevlkdrncdensevwqrvhvvyslskdlglpgfrvgaiysnddmvvaaatkmssfglvs
sqtqhllsamlsdkkltknyiaenhkrlkqrqkklvsglqksgisclngnaglfcwvdmr
hllrsntfeaemelwkkivyevhlnispgsschctepgwfrvcfanlpertldlamqrlk
afvge

SCOP Domain Coordinates for d1b8gb_:

Click to download the PDB-style file with coordinates for d1b8gb_.
(The format of our PDB-style files is described here.)

Timeline for d1b8gb_: