Lineage for d3r9bc_ (3r9b C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (73 species)
    not a true protein
  7. 2331949Species Mycobacterium smegmatis [TaxId:246196] [231662] (7 PDB entries)
  8. 2331956Domain d3r9bc_: 3r9b C: [344995]
    automated match to d5hdib_
    complexed with d12, edo, hem, k, na, po4

Details for d3r9bc_

PDB Entry: 3r9b (more details), 1.89 Å

PDB Description: Crystal structure of Mycobacterium smegmatis CYP164A2 in ligand free state
PDB Compounds: (C:) Cytochrome P450 164A2

SCOPe Domain Sequences for d3r9bc_:

Sequence, based on SEQRES records: (download)

>d3r9bc_ a.104.1.0 (C:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
aqglllqlldpatradpypiydrirrggplalpeanlavfssfsdcddvlrhpsscsdrt
kstifqrqlaaetqprpqgpasflfldppdhtrlrglvskafaprvikrlepeitalvdq
lldavdgpefnlidnlayplpvavicrllgvpiedepkfsrasallaaaldpflaltget
sdlfdeqmkagmwlrdylraliderrrtpgedlmsglvaveesgdqltedeiiatcnlll
iaghettvnlianaalamlrtpgqwaalaadgsrasavieetmrydppvqlvsryagddl
tigthtvpkgdtmllllaaahrdptivgapdrfdpdraqirhlgfgkgahfclgaplarl
eatvalpalaarfpearlsgepeykrnltlrgmstlsiav

Sequence, based on observed residues (ATOM records): (download)

>d3r9bc_ a.104.1.0 (C:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
aqglllqlldpatradpypiydrirrggplalpeanlavfssfsdcddvlrhpsscsdrt
kstifqrqlapasflfldppdhtrlrglvskafaprvikrlepeitalvdqlldavdgpe
fnlidnlayplpvavicrllgvpiedepkfsrasallaaaldpflaltgetsdlfdeqmk
agmwlrdylraliderrrtpgedlmsglvaveesgdqltedeiiatcnllliaghettvn
lianaalamlrtpgqwaalaadgsrasavieetmrydppvqlvsryagddltigthtvpk
gdtmllllaaahrdptivgapdrfdpdraqirhlgfgkgahfclgaplarleatvalpal
aarfpearlsgepeykrnltlrgmstlsiav

SCOPe Domain Coordinates for d3r9bc_:

Click to download the PDB-style file with coordinates for d3r9bc_.
(The format of our PDB-style files is described here.)

Timeline for d3r9bc_:

  • d3r9bc_ is new in SCOPe 2.07-stable