Lineage for d3qaca2 (3qac A:281-454)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2403752Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2404400Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 2404401Protein automated matches [190388] (26 species)
    not a true protein
  7. 2404470Species Prince's feather (Amaranthus hypochondriacus) [TaxId:28502] [346264] (1 PDB entry)
  8. 2404472Domain d3qaca2: 3qac A:281-454 [344990]
    automated match to d5wpwa2

Details for d3qaca2

PDB Entry: 3qac (more details), 2.27 Å

PDB Description: Structure of amaranth 11S proglobulin seed storage protein from Amaranthus hypochondriacus L.
PDB Compounds: (A:) 11S globulin seed storage protein

SCOPe Domain Sequences for d3qaca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qaca2 b.82.1.0 (A:281-454) automated matches {Prince's feather (Amaranthus hypochondriacus) [TaxId: 28502]}
ticsarlavnvddpskadvytpeagrlttvnsfnlpilrhlrlsaakgvlyrnammaphy
nlnahnimycvrgrgriqivndqgqsvfdeelsrgqlvvvpqnfaivkqafedgfewvsf
ktsenamfqslagrtsairslpidvvsniyqisreeafglkfnrpettlfrssg

SCOPe Domain Coordinates for d3qaca2:

Click to download the PDB-style file with coordinates for d3qaca2.
(The format of our PDB-style files is described here.)

Timeline for d3qaca2:

  • d3qaca2 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d3qaca1